Thioalkalivibrio versutus: TVD_03880 Help Entry TVD_03880         CDS       T03959                                  Name (GenBank) toxin of toxin-antitoxin system   KO K19158   toxin YoeB [EC:3.1.-.-] Organism tvr  Thioalkalivibrio versutus Brite KEGG Orthology (KO) [BR:tvr00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02048 Prokaryotic defense system [BR:tvr02048]     TVD_03880 Prokaryotic defense system [BR:tvr02048]  Toxin-antitoxin system (TA system)   Type II TA system    YoeB-YefM     TVD_03880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YoeB_toxin ParE_toxin ParE-like_toxin HigB-like_toxin Motif Other DBs NCBI-ProteinID:  AKJ94561 UniProt:  A0A0G3G6R5 LinkDB All DBs Position complement(813838..814101) Genome browser AA seq 87 aa AA seqDB search MTWSLVYTKQAQKDAKNLAASGLKPRTQALLDLLAEDPFRRPPPFEKLVGDLSGAYSRRI NIQHRIVYQVLGEERVVKVLRLWTHYE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgacctggtcgctcgtctatacgaaacaggcacagaaagacgcgaaaaatctggccgcc agcggtctgaaaccccgcacgcaggctctactggatctgctggccgaagacccttttcgc aggccgcccccgttcgagaaactggtgggggatctttccggcgcttattcccgccgcatc aacatccagcaccgcatcgtttatcaggttctgggagaagagcgtgtcgtgaaggttctt cggttatggacacactacgagtga

DBGET integrated database retrieval system