Thioalkalivibrio versutus: TVD_09990 Help Entry TVD_09990         CDS       T03959                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism tvr  Thioalkalivibrio versutus Brite KEGG Orthology (KO) [BR:tvr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tvr03036]     TVD_09990 Chromosome and associated proteins [BR:tvr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     TVD_09990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB TetR_C_24 GAS YabA DUF3450 TMF_TATA_bd K-box bZIP_1 ADIP GrpE HALZ APG6_N DUF724 Macoilin Csm1_N CCDC138_cc DivIC TolA_bind_tri Raptor_N UPF0242 DUF5082 TSC22 DUF1664 bZIP_2 Motif Other DBs NCBI-ProteinID:  AKJ95667 UniProt:  A0A0G3G859 LinkDB All DBs Position 2163067..2163294 Genome browser AA seq 75 aa AA seqDB search MQPNDDSAIDPTERLEAAITRLLEEHAALREENHLLQEQIRQLKGERATFKERNEQARHR VENMIARLRSMEHSE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgcagccgaacgacgattcagcgatcgacccgaccgaacgcctggaggccgcgatcacg cgccttctggaagagcatgcggccctgcgcgaggagaaccacctgttgcaggagcagatc cgccagctcaagggcgaacgcgcgaccttcaaggaacgcaacgaacaggcccgccaccgg gtcgagaacatgatcgcgcgcctgcgctcgatggagcacagcgaatga

DBGET integrated database retrieval system