Thioalkalivibrio versutus: TVD_11440 Help Entry TVD_11440         CDS       T03959                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism tvr  Thioalkalivibrio versutus Pathway tvr02024   Quorum sensing tvr03018   RNA degradation Brite KEGG Orthology (KO) [BR:tvr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     TVD_11440  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     TVD_11440  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tvr03019]     TVD_11440    03036 Chromosome and associated proteins [BR:tvr03036]     TVD_11440 Messenger RNA biogenesis [BR:tvr03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      TVD_11440 Chromosome and associated proteins [BR:tvr03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     TVD_11440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AKJ95928 UniProt:  A0A0G3G3X7 LinkDB All DBs Position complement(2477259..2477519) Genome browser AA seq 86 aa AA seqDB search MAKGQMLQEPFLNALRRDRIPVSIYLVNGIKLQGQIESFDQFVVLLRSTVSQMVYKHAIS TIVPARQVNMNLEGEAAAPASAEAES NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggccaaagggcaaatgttgcaggaacccttcctgaatgcgctgcgtcgggaccggatc ccggtctccatctacctggtgaacgggatcaagctgcaggggcagatcgaatccttcgac cagttcgtggtgctgctgcgcagtacggtctcgcagatggtgtacaagcacgccatctcc acgatcgtgccggcccgtcaggtgaacatgaatctcgagggcgaggcagcggctcccgcc tccgccgaggccgagtcctga

DBGET integrated database retrieval system