Thioalkalivibrio versutus: TVD_11520 Help Entry TVD_11520         CDS       T03959                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tvr  Thioalkalivibrio versutus Pathway tvr01100   Metabolic pathways tvr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tvr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TVD_11520    00074 Mycolic acid biosynthesis     TVD_11520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TVD_11520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKJ95943 UniProt:  A0A0G3G3Z1 LinkDB All DBs Position 2496940..2497212 Genome browser AA seq 90 aa AA seqDB search MPSQTAFEQEVAQLIVDSLNLEEVAPEDIEPEDALFREGLGLDSIDALELALAISRAYGV QIRSDDENNREIFASLRALSAHIEANRATS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgccatcacaaacagcgttcgaacaggaagtcgcccaactgatcgtggacagccttaat ctggaggaggtcgcgccggaggacatcgagccggaagatgcgctgttccgtgaaggactg gggctggattccatcgatgccctggagctggccctggccatctcccgcgcctacggcgtc cagatccggtcggacgacgaaaacaaccgcgagatcttcgcgtccttgcgtgcgctgagc gcccatatcgaggccaaccgagccacgtcgtga

DBGET integrated database retrieval system