Thermatribacter velox: QBE54_06265 Help Entry QBE54_06265       CDS       T10305                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tvx  Thermatribacter velox Pathway tvx01100   Metabolic pathways tvx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tvx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QBE54_06265    00074 Mycolic acid biosynthesis     QBE54_06265   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QBE54_06265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WZL75206 LinkDB All DBs Position 1259298..1259531 Genome browser AA seq 77 aa AA seqDB search MDVFSKVKEIIVDQLGVDEDEVTPDASFIDDLGADSLDIVELIMAFEEEFDIDIPDEDAE KITTVGEAVEYIESKIS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggacgttttctccaaagtaaaagaaattattgtagaccagcttggtgttgatgaggac gaggtaactcccgatgcgtcctttatagatgatctgggcgcagattctctggacattgtg gagctcataatggcttttgaagaagaattcgacattgatatcccagacgaagacgcagaa aaaatcaccactgtcggagaggctgtagaatacatagaatccaaaatcagctga

DBGET integrated database retrieval system