Thalassolituus hydrocarboniclasticus: HUF19_08535 Help Entry HUF19_08535       CDS       T08537                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism twan  Thalassolituus hydrocarboniclasticus Pathway twan01100   Metabolic pathways twan01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:twan00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HUF19_08535 (acpP)    00074 Mycolic acid biosynthesis     HUF19_08535 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HUF19_08535 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 AMPK_alpha_AID Motif Other DBs NCBI-ProteinID:  UXD87477 UniProt:  A0ABY6A9W6 LinkDB All DBs Position 1963182..1963415 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIVCEQLGVKEEDVKASSSFVDDLGADSLDTVELVMALEEEFETEIPDEDA EKLTTVQEAIDYIIANL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacattgaagaacgcgtaaagaaaatcgtatgtgaacagctgggtgttaaagaa gaagatgttaaggcttcatcctcttttgttgacgatctgggcgcggattctctggatact gtagagctggttatggctctggaagaagaattcgaaactgaaattcctgatgaagatgct gagaagctgacgaccgttcaggaagcgatcgactacatcatcgccaacctgtaa

DBGET integrated database retrieval system