KEGG   Thiorhodovibrio winogradskyi: Thiowin_00288
Entry
Thiowin_00288     CDS       T09736                                 
Symbol
yciB_1
Name
(GenBank) putative intracellular septation protein A
  KO
K06190  intracellular septation protein
Organism
twg  Thiorhodovibrio winogradskyi
Brite
KEGG Orthology (KO) [BR:twg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    Thiowin_00288 (yciB_1)
SSDB
Motif
Pfam: IspA
Other DBs
NCBI-ProteinID: WPL15392
UniProt: A0ABZ0S251
LinkDB
Position
complement(266582..267352)
AA seq 256 aa
MKFFTDLLPVILFFIAYKLSGIYIATLVAIAAAAAQVGWSRWRHGRVEKMHLITLGLLLL
FGGLTLALRDPIFVMWKPTIINWLFAGVFLGSFWVGHKPLTERMMGLAVHAPGAIWRRLN
WAWVGFFFVSGLANLYVIYVGSGFFAAQQALIAASGMPEMDLTHCATSFTGELLTLCESA
RTSEAIWVNFKLFGMMGLTLAFVIAQSFYLMRHVQAVEPGSCPLEARSTTDATDATAAAR
QSRESSPRTGQPRDLA
NT seq 771 nt   +upstreamnt  +downstreamnt
atgaaatttttcaccgatcttctcccggtcattctgttcttcatcgcctacaaactctct
ggcatctatatcgctaccctggtggccatcgcggccgcggccgcgcaggtgggctggtcg
cgatggcgccatgggcgggtggaaaagatgcatctgatcactctggggctgctattgctc
tttggcggtttaaccctggcgctgcgcgacccgatttttgtcatgtggaagcctacgatc
atcaactggctgtttgccggcgtctttctcggcagcttctgggtgggccacaagcctctg
acggagcgcatgatggggctggcggtgcatgcaccgggggccatctggcggcggctcaac
tgggcctgggttgggtttttctttgtatctggtttggccaatctttatgtcatctacgtt
ggcagcggcttttttgccgctcaacaggcgctgatcgcagccagtggcatgccggagatg
gatcttactcattgcgcgacctctttcaccggcgagctgctgacactgtgcgaaagcgca
cggacaagcgaggcgatttgggtcaacttcaagctgttcggtatgatggggttgacgctg
gcctttgtgattgcgcagtctttttacttaatgcgtcacgtgcaggcggtcgagcctggt
agttgtccgcttgaggccaggtcgacaacggatgccactgatgcaactgctgcagccaga
cagagccgcgagtcttcacccagaaccgggcagccgcgagatcttgcctga

DBGET integrated database retrieval system