Thiorhodovibrio winogradskyi: Thiowin_02815 Help Entry Thiowin_02815     CDS       T09736                                  Symbol atpE_1 Name (GenBank) Lipid-binding protein   KO K02110   F-type H+-transporting ATPase subunit c Organism twg  Thiorhodovibrio winogradskyi Pathway twg00190   Oxidative phosphorylation twg01100   Metabolic pathways Module twg_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:twg00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Thiowin_02815 (atpE_1)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:twg00194]     Thiowin_02815 (atpE_1) Photosynthesis proteins [BR:twg00194]  Photosystem and electron transport system   F-type ATPase [OT]    Thiowin_02815 (atpE_1) SSDB OrthologParalogGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WPL17773 UniProt:  A0ABZ0SBS4 LinkDB All DBs Position 3036013..3036246 Genome browser AA seq 77 aa AA seqDB search MELAQAVIFIAAGLMLGLGAVGAAIGIGVLGGRFLEGAARQPELIPMLRTQFFIVMGLTD ALPVISIAMGLYLMFAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggaacttgcacaagccgttatttttatcgccgctggtctgatgttgggtctgggtgcc gtcggcgccgctattggtatcggcgtgcttggtggccgcttcctcgagggcgcggcccgt cagccggaactcatcccaatgctgcgcacgcagttctttatcgtcatgggtcttaccgac gccctgccggtcatctcgatcgccatgggtctgtacttgatgttcgctgtctga

DBGET integrated database retrieval system