Tropheryma whipplei Twist: TWT_397 Help Entry TWT_397           CDS       T00116                                  Symbol rpi Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism twh  Tropheryma whipplei Twist Pathway twh00030   Pentose phosphate pathway twh00051   Fructose and mannose metabolism twh00710   Carbon fixation by Calvin cycle twh01100   Metabolic pathways twh01110   Biosynthesis of secondary metabolites twh01120   Microbial metabolism in diverse environments twh01200   Carbon metabolism twh01230   Biosynthesis of amino acids Module twh_M00004   Pentose phosphate pathway (Pentose phosphate cycle) twh_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:twh00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     TWT_397 (rpi)    00051 Fructose and mannose metabolism     TWT_397 (rpi)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     TWT_397 (rpi) Enzymes [BR:twh01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      TWT_397 (rpi) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB KOW6_SPT51-2 Motif Other DBs NCBI-ProteinID:  AAO44494 UniProt:  Q83GB5 LinkDB All DBs Position complement(486856..487323) Genome browser AA seq 155 aa AA seqDB search MSGRVHLATDHAGYEFSKGLLNFLADEHYQVVHHGAVNCDPEDDYPSFCIAAAEAVVRDI TDGIPSLGVVIGGSGNGEQIAANKVKGARAALAWNECTARLARAHNNANVVAIGARMHAH DEGFRIVLAFLREPFSEDSRHIRRIDAISLYECQS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgagcggcagggttcatctggctaccgatcatgccggttatgagttctctaaaggtctt ttgaactttcttgctgatgagcattatcaggttgttcatcatggtgcagttaattgtgat cctgaggatgattatccatctttctgcatcgctgcggcagaggctgtagtacgggatatt acagacggtattccatctcttggggttgttatcggtggcagcggaaacggtgaacagata gctgcaaataaggttaagggtgcaagggccgccctggcgtggaatgagtgtaccgctcgt cttgccagggcacacaataatgcaaacgtagttgccatcggtgcaagaatgcatgcccat gacgagggttttcggatagttttggcatttctacgggaaccattcagtgaggactcgcgg catatcagaaggatagatgcgataagtttgtatgagtgtcagtcttga

DBGET integrated database retrieval system