Tripterygium wilfordii (thunder duke vine): 119989407
Help
Entry
119989407 CDS
T07256
Name
(RefSeq) SKP1-like protein 1B
KO
K03094
S-phase kinase-associated protein 1
Organism
twl
Tripterygium wilfordii (thunder duke vine)
Pathway
twl03083
Polycomb repressive complex
twl04120
Ubiquitin mediated proteolysis
twl04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
twl00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
119989407
04120 Ubiquitin mediated proteolysis
119989407
09126 Chromosome
03083 Polycomb repressive complex
119989407
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
twl04131
]
119989407
04121 Ubiquitin system [BR:
twl04121
]
119989407
03036 Chromosome and associated proteins [BR:
twl03036
]
119989407
Membrane trafficking [BR:
twl04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
119989407
Ubiquitin system [BR:
twl04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
119989407
Cul7 complex
119989407
Chromosome and associated proteins [BR:
twl03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
119989407
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
119989407
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
BTB
IFT52_central
Motif
Other DBs
NCBI-GeneID:
119989407
NCBI-ProteinID:
XP_038690837
LinkDB
All DBs
Position
21:complement(17782371..17783431)
Genome browser
AA seq
150 aa
AA seq
DB search
MSSSKKITLVSSDGEVFEVEEAVVMEAAAIKRMIEDDCADGKIPLPNVKSKTLSKILEYC
MKHAEDKDAAGNLKSFDSDFMKVDTNTLYDLLMAANYLEIKKLLGLCCQTVTDMIKGKTP
EQIRETFNIKNDFSAEEEDEIRNQNKWAFE
NT seq
453 nt
NT seq
+upstream
nt +downstream
nt
atgtcgagctccaagaagatcactctagtgagttctgatggagaggtgtttgaggtggag
gaggcggtggtgatggaggcagcggccataaagcgcatgattgaagacgattgcgctgat
ggaaaaatccctctgcccaacgtgaagagcaagactctgtccaagatacttgagtactgc
atgaagcacgcggaagacaaggatgccgctggaaatctcaaatccttcgactcagacttc
atgaaggtagacacgaacactctgtatgatctacttatggcagcaaactatctggagatc
aagaagttgcttggtttgtgctgccaaaccgtaacagacatgatcaaggggaagactcct
gaacaaattcgtgagacattcaacatcaagaacgacttttctgccgaggaagaagacgaa
attaggaatcaaaacaaatgggcttttgaatga
DBGET
integrated database retrieval system