Tripterygium wilfordii (thunder duke vine): 120006453
Help
Entry
120006453 CDS
T07256
Name
(RefSeq) SKP1-like protein 1B
KO
K03094
S-phase kinase-associated protein 1
Organism
twl
Tripterygium wilfordii (thunder duke vine)
Pathway
twl03083
Polycomb repressive complex
twl04120
Ubiquitin mediated proteolysis
twl04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
twl00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
120006453
04120 Ubiquitin mediated proteolysis
120006453
09126 Chromosome
03083 Polycomb repressive complex
120006453
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
twl04131
]
120006453
04121 Ubiquitin system [BR:
twl04121
]
120006453
03036 Chromosome and associated proteins [BR:
twl03036
]
120006453
Membrane trafficking [BR:
twl04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
120006453
Ubiquitin system [BR:
twl04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
120006453
Cul7 complex
120006453
Chromosome and associated proteins [BR:
twl03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
120006453
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
120006453
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1_POZ
Skp1
Motif
Other DBs
NCBI-GeneID:
120006453
NCBI-ProteinID:
XP_038712426
LinkDB
All DBs
Position
9:1357690..1358328
Genome browser
AA seq
152 aa
AA seq
DB search
MASSKKITLISSDGERFEVEEAVALKSQTVKHMIEDECGDNGIPTPNVTSTILAKVIEYC
KKHVDSSSSEDEGLKNWDAEFAKVDLATLIDLIWAANYLNIKGLLDLTCQTVANMMKERS
PEEMRKIFHIKNDYTPEEEEEVRREISWAFSD
NT seq
459 nt
NT seq
+upstream
nt +downstream
nt
atggcttcttcgaagaaaattactctaatcagttccgacggtgagcgatttgaggtggaa
gaggcggtggctctgaaatctcaaactgtgaagcacatgatcgaggacgagtgtggcgac
aacggcatccctacacccaacgtgacgagcacgattcttgcgaaagtaatcgagtattgc
aagaagcacgtcgattcgtcgtcgtccgaggatgaaggtctgaaaaactgggacgcggag
ttcgcaaaagtggacctagctacacttattgatctgatttgggctgcaaattacttgaac
atcaagggactgctggacttgacctgccaaactgtggcgaacatgatgaaggaacggtct
ccggaggagatgaggaagatttttcacatcaagaatgattatactcctgaagaagaggaa
gaggttcgccgtgagatcagttgggcattcagtgattga
DBGET
integrated database retrieval system