KEGG   Tripterygium wilfordii (thunder duke vine): 120012778
Entry
120012778         CDS       T07256                                 
Name
(RefSeq) aspartate aminotransferase, mitochondrial-like isoform X1
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
twl  Tripterygium wilfordii (thunder duke vine)
Pathway
twl00220  Arginine biosynthesis
twl00250  Alanine, aspartate and glutamate metabolism
twl00270  Cysteine and methionine metabolism
twl00330  Arginine and proline metabolism
twl00350  Tyrosine metabolism
twl00360  Phenylalanine metabolism
twl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
twl00710  Carbon fixation by Calvin cycle
twl00950  Isoquinoline alkaloid biosynthesis
twl00960  Tropane, piperidine and pyridine alkaloid biosynthesis
twl01100  Metabolic pathways
twl01110  Biosynthesis of secondary metabolites
twl01200  Carbon metabolism
twl01210  2-Oxocarboxylic acid metabolism
twl01230  Biosynthesis of amino acids
Module
twl_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
twl_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:twl00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    120012778
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    120012778
   00270 Cysteine and methionine metabolism
    120012778
   00220 Arginine biosynthesis
    120012778
   00330 Arginine and proline metabolism
    120012778
   00350 Tyrosine metabolism
    120012778
   00360 Phenylalanine metabolism
    120012778
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    120012778
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    120012778
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    120012778
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:twl01007]
    120012778
Enzymes [BR:twl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     120012778
Amino acid related enzymes [BR:twl01007]
 Aminotransferase (transaminase)
  Class I
   120012778
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 120012778
NCBI-ProteinID: XP_038720196
LinkDB
Position
13:1030022..1033723
AA seq 444 aa
MITIGVVMRSYRLMGTSRLMSSSASAVKWWDHVAPAPKDPIAGLTEAFLADTSPYKINLG
VGAYRDDEGKPVVLQCVREANAKIAGCDFFFVRETIPHAVSTKLVEESIKLVYGNDSDFV
EETKVAGVQALSGTGACRLFAEFQKKFCPKSQIYFPDPTWSCHHKIWREAHIPQRTFRYY
DLCSKGLNFTAMMDDIKNAPDGSFFLLHPCAHNPTGVDPTEEQWREISHLFKVKNHFPFF
DMAYQGLASGDLDRDAQVIRKFVEDGHLVGCAQSFAKNMGLYGQRIGCLSVLCADAKQAA
AIKSQMQQIAGAMYGSPPVLGPLLVSAILSDPDIKALWATEVKAMTERIRRMRINLRESL
EKLDSPLNWEQITNQVGMFFFSGLTPDQVDCLRREFHIFMNPDGRISMAGVTTGNVNYLA
NALHEVTRFNQESYVLTSLRSDSG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgatcactatcggcgtcgtaatgcggagctatcgtttgatggggacgagtaggctcatg
tcaagctcagccagtgctgtgaagtggtgggaccatgtggcaccggctcccaaggatccc
attgctggcctcacggaggcgtttcttgctgacactagcccctacaagatcaatcttgga
gtgggagcttacagagatgatgaggggaaacctgttgtgcttcagtgtgttagagaagcc
aacgcgaagattgccggttgtgatttcttctttgtcagggagacaattcctcatgcagtc
agcacaaagcttgttgaggaaagcattaagttggtttatgggaacgactcggattttgta
gaagaaacgaaggttgctggagttcaagccctttctggcactggtgcatgtcgtcttttt
gctgagttccagaagaaattctgtccgaaatctcaaatatattttcctgatccaacttgg
tcatgccaccataaaatttggagagaggctcatattccacaaagaacctttcgatattat
gatctttgttctaagggcttgaactttactgcaatgatggatgatatcaagaatgcccct
gatggttcattcttcctactccacccttgtgctcacaacccaactggagttgaccctact
gaagaacagtggagagaaatttcacatctgttcaaggtaaagaatcactttcccttcttt
gatatggcttatcaaggtttagcaagtggagaccttgacagggatgcacaagttatccgc
aagtttgtcgaagatgggcatttagtgggctgtgcacaatcctttgcaaagaacatggga
ttatatggacaacgaattggttgtcttagtgttctttgcgctgatgcaaagcaagcagct
gcaattaaaagtcaaatgcagcaaattgctggtgcaatgtatggcagtcctcctgtcctt
ggccctttattagtttcagcaatcctaagtgacccagatataaaggctctttgggctact
gaagtgaaggccatgacagaacgaattcgaagaatgcggatcaatctgcgagaaagcctt
gagaaattagattctcctctcaattgggaacagataacaaaccaggttggaatgtttttc
ttctctggcttaactcctgatcaggttgattgtctacggagagaattccacatattcatg
aatcccgacggacgtataagcatggcaggtgtgactacaggcaatgtaaattacttagca
aatgctttacatgaggtcaccagatttaatcaggagtcctacgttctcacaagtctccgc
tccgactctggttaa

DBGET integrated database retrieval system