KEGG   Thiothrix winogradskyi: L2Y54_04530
Entry
L2Y54_04530       CDS       T08347                                 
Name
(GenBank) hypothetical protein
Organism
twn  Thiothrix winogradskyi
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-ProteinID: UJS25312
UniProt: A0ABY3T0I1
LinkDB
Position
complement(864330..865442)
AA seq 370 aa
MKQFVKKTLAMLVGAMLLSPVAFAEQQGMGGMSGMQGMGGMSGMQGMGGMSGMQGMGGMS
GMQGMGGMDGMSGMSGMAGRQQGMSGMSGMGGMSGMQGMGGMNGMSGMSGMDGMSGMDGM
SGMSGMGGMSGMQGMGGMSGMAGQQGAWVWVPDQTGMGGMSGMQGMGGMGGMSGMNGMSG
MNGMSGMGGMSGMQGMGGMNGMAGMQGMSGMAGQGGKWVWMPTQSGMGGMNGMSGMGGMN
GMSGMNGMSGMGGMSGMNGMSGMGGMNGMSGMGGMNGMSGMNGMSGMNGMSGMNGMSGMN
GMSGMNGMSGMGGMSGMNGMSGMDGMSGMNGMSGMGGMSGMNGMSGMGGMSGMQGMGGMS
GMQGWTPPTK
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaaacagtttgttaaaaaaaccttggctatgttggttggtgctatgctgctgtcaccg
gtggcatttgccgaacaacaaggcatgggcggtatgtccgggatgcaaggcatgggcggt
atgtctggaatgcagggcatgggcggcatgtctggaatgcagggcatgggcggcatgtct
ggaatgcagggcatgggcggtatggatggcatgtcaggcatgtccggcatggctggacgg
cagcaaggtatgagtggtatgtcaggcatgggcggcatgtccgggatgcaaggcatgggt
ggcatgaacggtatgtcaggcatgtccggcatggatggcatgtccggcatggatggcatg
agtggtatgtcaggcatgggtggcatgtccgggatgcaaggcatgggtggcatgtccggg
atggcgggtcagcaaggcgcttgggtttgggttcctgaccagacaggcatgggtggtatg
tctgggatgcaaggcatgggcggcatgggcggcatgtcaggaatgaacggcatgtccggg
atgaacggtatgtcaggcatgggcggcatgtccgggatgcaaggcatgggcggtatgaat
ggcatggcagggatgcagggaatgtccggcatggcaggtcaaggcggtaaatgggtttgg
atgcctacccaaagtggcatgggcggcatgaacggtatgtcaggcatgggtggcatgaac
ggtatgtcgggcatgaacggtatgtcgggcatgggcggcatgtccgggatgaacggtatg
tcaggcatgggtggcatgaacggtatgtcaggcatgggtggcatgaacggtatgtcgggc
atgaacggtatgtcgggcatgaacggtatgtcgggcatgaacggtatgtcgggcatgaac
ggtatgtcgggcatgaacggtatgtcgggcatgggcggcatgtccgggatgaacggtatg
tcaggcatggatggcatgtccgggatgaacggtatgtcaggcatgggcggcatgtccggg
atgaacggtatgtcaggcatgggcggcatgtccgggatgcaaggcatgggcggcatgtct
ggtatgcaaggttggacaccaccaaccaaataa

DBGET integrated database retrieval system