Thermodesulfovibrio yellowstonii: THEYE_A1813 Help Entry THEYE_A1813       CDS       T00775                                  Name (GenBank) conserved domain protein   KO K03116   sec-independent protein translocase protein TatA Organism tye  Thermodesulfovibrio yellowstonii Pathway tye03060   Protein export tye03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:tye00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     THEYE_A1813  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     THEYE_A1813  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tye02044]     THEYE_A1813 Secretion system [BR:tye02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    THEYE_A1813 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Phage_ORF5 Motif Other DBs NCBI-ProteinID:  ACI22083 UniProt:  B5YHL8 LinkDB All DBs Position 1739008..1739202 Genome browser AA seq 64 aa AA seqDB search MLSYQDLFLFSIIIIVLFGSSKLPEIGKGLGEAIRGFKKAVSDSESNSNKDMDETLKIEH KKQS NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgcttagttatcaagatttatttcttttttcaataattataattgttctttttggttca tcaaagctacctgaaattggtaaaggactgggagaagctataagaggattcaaaaaagca gtatcagactcagagtcaaattcaaataaagatatggacgaaactttaaaaattgaacat aagaaacaaagttaa

DBGET integrated database retrieval system