Thiosulfativibrio zosterae: THMIRHAT_07950 Help Entry THMIRHAT_07950    CDS       T06856                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism tzo  Thiosulfativibrio zosterae Brite KEGG Orthology (KO) [BR:tzo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tzo03036]     THMIRHAT_07950    03400 DNA repair and recombination proteins [BR:tzo03400]     THMIRHAT_07950 Chromosome and associated proteins [BR:tzo03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     THMIRHAT_07950 DNA repair and recombination proteins [BR:tzo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       THMIRHAT_07950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YecR DASH_Dad3 ElaD_SseL-like_N EMC3_TMCO1 Motif Other DBs NCBI-ProteinID:  BBP43049 UniProt:  A0A6F8PLR7 LinkDB All DBs Position 938154..938330 Genome browser AA seq 58 aa AA seqDB search MKSYDELKAEMEAIQQQMVEAKKNERANALKEVKRLCKEFGFTAGMLKGSLAKGRGVQ NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgaaatcttatgacgagttgaaagctgaaatggaagcaattcagcagcagatggttgaa gctaagaagaacgaacgtgctaacgcactgaaggaagtaaaacgtctttgtaaagagttt ggctttactgctggcatgttaaaaggatcattggccaaaggaagaggcgtacaatga

DBGET integrated database retrieval system