Ursus arctos (brown bear): 113241128 Help Entry 113241128         CDS       T05909                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism uah  Ursus arctos (brown bear) Pathway uah04014   Ras signaling pathway uah04015   Rap1 signaling pathway uah04020   Calcium signaling pathway uah04022   cGMP-PKG signaling pathway uah04024   cAMP signaling pathway uah04070   Phosphatidylinositol signaling system uah04114   Oocyte meiosis uah04218   Cellular senescence uah04261   Adrenergic signaling in cardiomyocytes uah04270   Vascular smooth muscle contraction uah04371   Apelin signaling pathway uah04625   C-type lectin receptor signaling pathway uah04713   Circadian entrainment uah04720   Long-term potentiation uah04722   Neurotrophin signaling pathway uah04728   Dopaminergic synapse uah04740   Olfactory transduction uah04744   Phototransduction uah04750   Inflammatory mediator regulation of TRP channels uah04910   Insulin signaling pathway uah04912   GnRH signaling pathway uah04915   Estrogen signaling pathway uah04916   Melanogenesis uah04921   Oxytocin signaling pathway uah04922   Glucagon signaling pathway uah04924   Renin secretion uah04925   Aldosterone synthesis and secretion uah04970   Salivary secretion uah04971   Gastric acid secretion uah05010   Alzheimer disease uah05012   Parkinson disease uah05022   Pathways of neurodegeneration - multiple diseases uah05031   Amphetamine addiction uah05034   Alcoholism uah05133   Pertussis uah05152   Tuberculosis uah05163   Human cytomegalovirus infection uah05167   Kaposi sarcoma-associated herpesvirus infection uah05170   Human immunodeficiency virus 1 infection uah05200   Pathways in cancer uah05214   Glioma uah05417   Lipid and atherosclerosis uah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     113241128    04015 Rap1 signaling pathway     113241128    04371 Apelin signaling pathway     113241128    04020 Calcium signaling pathway     113241128    04070 Phosphatidylinositol signaling system     113241128    04024 cAMP signaling pathway     113241128    04022 cGMP-PKG signaling pathway     113241128  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     113241128    04218 Cellular senescence     113241128  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113241128   09152 Endocrine system    04910 Insulin signaling pathway     113241128    04922 Glucagon signaling pathway     113241128    04912 GnRH signaling pathway     113241128    04915 Estrogen signaling pathway     113241128    04921 Oxytocin signaling pathway     113241128    04916 Melanogenesis     113241128    04924 Renin secretion     113241128    04925 Aldosterone synthesis and secretion     113241128   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     113241128    04270 Vascular smooth muscle contraction     113241128   09154 Digestive system    04970 Salivary secretion     113241128    04971 Gastric acid secretion     113241128   09156 Nervous system    04728 Dopaminergic synapse     113241128    04720 Long-term potentiation     113241128    04722 Neurotrophin signaling pathway     113241128   09157 Sensory system    04744 Phototransduction     113241128    04740 Olfactory transduction     113241128    04750 Inflammatory mediator regulation of TRP channels     113241128   09159 Environmental adaptation    04713 Circadian entrainment     113241128  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     113241128   09162 Cancer: specific types    05214 Glioma     113241128   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     113241128    05163 Human cytomegalovirus infection     113241128    05167 Kaposi sarcoma-associated herpesvirus infection     113241128   09171 Infectious disease: bacterial    05133 Pertussis     113241128    05152 Tuberculosis     113241128   09164 Neurodegenerative disease    05010 Alzheimer disease     113241128    05012 Parkinson disease     113241128    05022 Pathways of neurodegeneration - multiple diseases     113241128   09165 Substance dependence    05031 Amphetamine addiction     113241128    05034 Alcoholism     113241128   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     113241128    05418 Fluid shear stress and atherosclerosis     113241128  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:uah01009]     113241128   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uah04131]     113241128    03036 Chromosome and associated proteins [BR:uah03036]     113241128   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113241128 Protein phosphatases and associated proteins [BR:uah01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      113241128 Membrane trafficking [BR:uah04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     113241128 Chromosome and associated proteins [BR:uah03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      113241128 Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113241128 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 EF_EFCAB10_C EH Dockerin_1 Temptin_C EF-hand_11 EFhand_Ca_insen Caleosin DUF5580_M SurA_N_3 SurA_N_2 Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  113241128 NCBI-ProteinID:  XP_026334480 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLSEEQVAEFKEAFCLFDKDGDGVITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG NGSVDFPEFLGMMARQLKGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDE EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgagcgaggaacaggtggccgagttcaaggaggccttctgcctgttt gacaaggacggggatggcgtcatcaccacccaggagctgggcaccgtcatgcgctccctg ggccagaaccccacggaggccgagctgcgtgacatggtgggcgagatcgaccgggacggc aacggctccgtggacttccccgagttcctgggcatgatggccaggcagctgaagggcagg gacagcgaggagcagatccgcgaagccttccgtgtcttcgacaaggacggcaatggcctg gtgagtgcggccgagctgcggcacgtgatgacccggctgggggagaagctgagtgacgag gaggtggacgagatgatccgggccgccgacgtggacggggacgggcaggtgaactacgag gagttcgtccacatgctggtgtccaagtga

DBGET integrated database retrieval system