KEGG   Ursus arctos (brown bear): 113247020
Entry
113247020         CDS       T05909                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
uah  Ursus arctos (brown bear)
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah01524  Platinum drug resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04114  Oocyte meiosis
uah04140  Autophagy - animal
uah04148  Efferocytosis
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04218  Cellular senescence
uah04261  Adrenergic signaling in cardiomyocytes
uah04270  Vascular smooth muscle contraction
uah04350  TGF-beta signaling pathway
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04371  Apelin signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04517  IgSF CAM signaling
uah04520  Adherens junction
uah04540  Gap junction
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04613  Neutrophil extracellular trap formation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04668  TNF signaling pathway
uah04713  Circadian entrainment
uah04720  Long-term potentiation
uah04722  Neurotrophin signaling pathway
uah04723  Retrograde endocannabinoid signaling
uah04724  Glutamatergic synapse
uah04725  Cholinergic synapse
uah04726  Serotonergic synapse
uah04730  Long-term depression
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04912  GnRH signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04916  Melanogenesis
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04921  Oxytocin signaling pathway
uah04926  Relaxin signaling pathway
uah04928  Parathyroid hormone synthesis, secretion and action
uah04929  GnRH secretion
uah04930  Type II diabetes mellitus
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04934  Cushing syndrome
uah04935  Growth hormone synthesis, secretion and action
uah04960  Aldosterone-regulated sodium reabsorption
uah05010  Alzheimer disease
uah05020  Prion disease
uah05022  Pathways of neurodegeneration - multiple diseases
uah05034  Alcoholism
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05171  Coronavirus disease - COVID-19
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05207  Chemical carcinogenesis - receptor activation
uah05208  Chemical carcinogenesis - reactive oxygen species
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05216  Thyroid cancer
uah05218  Melanoma
uah05219  Bladder cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113247020 (MAPK1)
   04012 ErbB signaling pathway
    113247020 (MAPK1)
   04014 Ras signaling pathway
    113247020 (MAPK1)
   04015 Rap1 signaling pathway
    113247020 (MAPK1)
   04350 TGF-beta signaling pathway
    113247020 (MAPK1)
   04370 VEGF signaling pathway
    113247020 (MAPK1)
   04371 Apelin signaling pathway
    113247020 (MAPK1)
   04668 TNF signaling pathway
    113247020 (MAPK1)
   04066 HIF-1 signaling pathway
    113247020 (MAPK1)
   04068 FoxO signaling pathway
    113247020 (MAPK1)
   04072 Phospholipase D signaling pathway
    113247020 (MAPK1)
   04071 Sphingolipid signaling pathway
    113247020 (MAPK1)
   04024 cAMP signaling pathway
    113247020 (MAPK1)
   04022 cGMP-PKG signaling pathway
    113247020 (MAPK1)
   04151 PI3K-Akt signaling pathway
    113247020 (MAPK1)
   04150 mTOR signaling pathway
    113247020 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    113247020 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113247020 (MAPK1)
   04148 Efferocytosis
    113247020 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    113247020 (MAPK1)
   04210 Apoptosis
    113247020 (MAPK1)
   04218 Cellular senescence
    113247020 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113247020 (MAPK1)
   04520 Adherens junction
    113247020 (MAPK1)
   04540 Gap junction
    113247020 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    113247020 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113247020 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113247020 (MAPK1)
   04613 Neutrophil extracellular trap formation
    113247020 (MAPK1)
   04620 Toll-like receptor signaling pathway
    113247020 (MAPK1)
   04621 NOD-like receptor signaling pathway
    113247020 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    113247020 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    113247020 (MAPK1)
   04660 T cell receptor signaling pathway
    113247020 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    113247020 (MAPK1)
   04659 Th17 cell differentiation
    113247020 (MAPK1)
   04657 IL-17 signaling pathway
    113247020 (MAPK1)
   04662 B cell receptor signaling pathway
    113247020 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    113247020 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    113247020 (MAPK1)
   04062 Chemokine signaling pathway
    113247020 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113247020 (MAPK1)
   04929 GnRH secretion
    113247020 (MAPK1)
   04912 GnRH signaling pathway
    113247020 (MAPK1)
   04915 Estrogen signaling pathway
    113247020 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    113247020 (MAPK1)
   04917 Prolactin signaling pathway
    113247020 (MAPK1)
   04921 Oxytocin signaling pathway
    113247020 (MAPK1)
   04926 Relaxin signaling pathway
    113247020 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    113247020 (MAPK1)
   04919 Thyroid hormone signaling pathway
    113247020 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    113247020 (MAPK1)
   04916 Melanogenesis
    113247020 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113247020 (MAPK1)
   04270 Vascular smooth muscle contraction
    113247020 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113247020 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    113247020 (MAPK1)
   04725 Cholinergic synapse
    113247020 (MAPK1)
   04726 Serotonergic synapse
    113247020 (MAPK1)
   04720 Long-term potentiation
    113247020 (MAPK1)
   04730 Long-term depression
    113247020 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    113247020 (MAPK1)
   04722 Neurotrophin signaling pathway
    113247020 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    113247020 (MAPK1)
   04380 Osteoclast differentiation
    113247020 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    113247020 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113247020 (MAPK1)
   05206 MicroRNAs in cancer
    113247020 (MAPK1)
   05205 Proteoglycans in cancer
    113247020 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    113247020 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    113247020 (MAPK1)
   05203 Viral carcinogenesis
    113247020 (MAPK1)
   05230 Central carbon metabolism in cancer
    113247020 (MAPK1)
   05231 Choline metabolism in cancer
    113247020 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113247020 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113247020 (MAPK1)
   05212 Pancreatic cancer
    113247020 (MAPK1)
   05225 Hepatocellular carcinoma
    113247020 (MAPK1)
   05226 Gastric cancer
    113247020 (MAPK1)
   05214 Glioma
    113247020 (MAPK1)
   05216 Thyroid cancer
    113247020 (MAPK1)
   05221 Acute myeloid leukemia
    113247020 (MAPK1)
   05220 Chronic myeloid leukemia
    113247020 (MAPK1)
   05218 Melanoma
    113247020 (MAPK1)
   05211 Renal cell carcinoma
    113247020 (MAPK1)
   05219 Bladder cancer
    113247020 (MAPK1)
   05215 Prostate cancer
    113247020 (MAPK1)
   05213 Endometrial cancer
    113247020 (MAPK1)
   05224 Breast cancer
    113247020 (MAPK1)
   05223 Non-small cell lung cancer
    113247020 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113247020 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    113247020 (MAPK1)
   05161 Hepatitis B
    113247020 (MAPK1)
   05160 Hepatitis C
    113247020 (MAPK1)
   05171 Coronavirus disease - COVID-19
    113247020 (MAPK1)
   05164 Influenza A
    113247020 (MAPK1)
   05163 Human cytomegalovirus infection
    113247020 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113247020 (MAPK1)
   05165 Human papillomavirus infection
    113247020 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113247020 (MAPK1)
   05135 Yersinia infection
    113247020 (MAPK1)
   05133 Pertussis
    113247020 (MAPK1)
   05152 Tuberculosis
    113247020 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113247020 (MAPK1)
   05140 Leishmaniasis
    113247020 (MAPK1)
   05142 Chagas disease
    113247020 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113247020 (MAPK1)
   05020 Prion disease
    113247020 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    113247020 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    113247020 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    113247020 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113247020 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113247020 (MAPK1)
   04934 Cushing syndrome
    113247020 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113247020 (MAPK1)
   01524 Platinum drug resistance
    113247020 (MAPK1)
   01522 Endocrine resistance
    113247020 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113247020 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:uah03036]
    113247020 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113247020 (MAPK1)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113247020 (MAPK1)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113247020 (MAPK1)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     113247020 (MAPK1)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113247020 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 113247020
NCBI-ProteinID: XP_026343610
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgatattattcgagcaccaaccatcgagcaaatgaaagat
gtgtatatagtacaggacctcatggaaacagatctatacaagctcttgaagacgcaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaatgtactgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccatgatcac
acagggttcctgacggagtatgtagccacacgttggtacagggctccggaaattatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctgtccaacaggcccatcttcccggggaagcattatctcgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaactgtataataaatttaaaagct
agaaactacttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggatttactggacaaaatgttgacattcaaccctcacaag
aggattgaagtagaacaggctctggcccatccatatctggagcagtattatgacccaagc
gatgagcccatcgctgaggcgccattcaagtttgacatggagctggatgacctgcccaag
gaaaagctcaaagagctcatcttcgaagagacagctagattccagccgggatacagatct
taa

DBGET integrated database retrieval system