Ursus arctos (brown bear): 113247226 Help Entry 113247226         CDS       T05909                                  Name (RefSeq) late histone H2B.L4   KO K11252   histone H2B Organism uah  Ursus arctos (brown bear) Pathway uah04613   Neutrophil extracellular trap formation uah05034   Alcoholism uah05203   Viral carcinogenesis uah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     113247226  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     113247226   09163 Immune disease    05322 Systemic lupus erythematosus     113247226   09165 Substance dependence    05034 Alcoholism     113247226  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uah03036]     113247226   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113247226 Chromosome and associated proteins [BR:uah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113247226 Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113247226 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  113247226 NCBI-ProteinID:  XP_044235953 LinkDB All DBs Position X Genome browser AA seq 140 aa AA seqDB search MAEPGCEPSSEESLGTEEPSAADPKSPKQKQPRHQCRGHRHIRRPDSFATYFPRVLKQVH EGLSLSKKAVSVMDSFVKDIFERIADEAARLARSTKGFNKHSTISSREIQTAVRLLLPGE IGKHAVSEATKAIIRYTLCQ NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctgagcctggctgtgagccctcttctgaggaaagcctgggcacggaggagccctcg gcagccgacccaaagagcccgaagcaaaagcagccgaggcaccagtgccgcggccaccgc cacatccgccgccccgacagtttcgccacctacttccccagggttctgaagcaggtgcac gagggcctgagcctctcgaagaaggccgtgagcgtcatggattcgttcgttaaggatatc ttcgagcgcatcgccgacgaggccgctcgtctggctcgctccaccaagggcttcaacaag cactccaccatcagctccagggagatccagacagccgtgcgcctgctgctgcccggggag atcggcaagcacgccgtgtccgaggccaccaaggccatcatcaggtacaccttatgccaa tga

DBGET integrated database retrieval system