Ursus arctos (brown bear): 113247234 Help Entry 113247234         CDS       T05909                                  Name (RefSeq) histone H2B type F-S-like   KO K11252   histone H2B Organism uah  Ursus arctos (brown bear) Pathway uah04613   Neutrophil extracellular trap formation uah05034   Alcoholism uah05203   Viral carcinogenesis uah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     113247234  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     113247234   09163 Immune disease    05322 Systemic lupus erythematosus     113247234   09165 Substance dependence    05034 Alcoholism     113247234  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uah03036]     113247234   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113247234 Chromosome and associated proteins [BR:uah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113247234 Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113247234 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  113247234 NCBI-ProteinID:  XP_026343951 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search RQSGRQRERRKESYNIYLYKVLKQVHKGLSLSQKAVGVVGSFVKDVFERIADEAAPAKRS SKHSTISSREMQTALRPLLPGEIGKHAVSEATKAIIRDTFRQ NT seq 309 nt NT seq  +upstreamnt  +downstreamnt aggcagagcggcaggcagagggagaggagaaaggagagttataacatctacctgtacaag gttctgaagcaggtgcacaagggcctgagcctctcgcagaaggccgtgggcgtcgtgggt tcgttcgttaaggatgtcttcgagcgcatcgccgacgaggccgctccagccaagcgctcc agcaagcactccaccatcagctccagggagatgcagacagccctgcgcccgctgctgccc ggggagatcggcaagcacgccgtgtccgaggccaccaaggccatcatcagggacaccttt cgccagtga

DBGET integrated database retrieval system