Ursus arctos (brown bear): 113247437
Help
Entry
113247437 CDS
T05909
Symbol
NDUFA3
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
KO
K03947
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 3
Organism
uah
Ursus arctos (brown bear)
Pathway
uah00190
Oxidative phosphorylation
uah01100
Metabolic pathways
uah04714
Thermogenesis
uah04723
Retrograde endocannabinoid signaling
uah04932
Non-alcoholic fatty liver disease
uah05010
Alzheimer disease
uah05012
Parkinson disease
uah05014
Amyotrophic lateral sclerosis
uah05016
Huntington disease
uah05020
Prion disease
uah05022
Pathways of neurodegeneration - multiple diseases
uah05208
Chemical carcinogenesis - reactive oxygen species
uah05415
Diabetic cardiomyopathy
Module
uah_M00146
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:
uah00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
113247437 (NDUFA3)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
113247437 (NDUFA3)
09159 Environmental adaptation
04714 Thermogenesis
113247437 (NDUFA3)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
113247437 (NDUFA3)
09164 Neurodegenerative disease
05010 Alzheimer disease
113247437 (NDUFA3)
05012 Parkinson disease
113247437 (NDUFA3)
05014 Amyotrophic lateral sclerosis
113247437 (NDUFA3)
05016 Huntington disease
113247437 (NDUFA3)
05020 Prion disease
113247437 (NDUFA3)
05022 Pathways of neurodegeneration - multiple diseases
113247437 (NDUFA3)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
113247437 (NDUFA3)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
113247437 (NDUFA3)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
NADHdh_A3
Motif
Other DBs
NCBI-GeneID:
113247437
NCBI-ProteinID:
XP_026344320
LinkDB
All DBs
Position
Unknown
AA seq
84 aa
AA seq
DB search
MAGRLATFLKDAWAKEPVLVASFTIGGLAVILPTLSPFTKYATMINQVTPYNYPVPLRDD
GSMPDVPSHPQDPQGPSMEWLKKL
NT seq
255 nt
NT seq
+upstream
nt +downstream
nt
atggcgggcagactcgccaccttcctcaaggatgcctgggccaaggagccggtgctggtc
gcgtccttcaccatcgggggcctcgctgtaattctgcccaccctcagccccttcaccaaa
tacgccaccatgatcaaccaggtcacgccctacaactatccagtgcccctccgagatgat
gggagcatgcccgacgtgcccagccacccccaggacccccagggcccaagcatggagtgg
ctgaagaaactgtga
DBGET
integrated database retrieval system