Ursus arctos (brown bear): 113250165 Help Entry 113250165         CDS       T05909                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism uah  Ursus arctos (brown bear) Pathway uah04613   Neutrophil extracellular trap formation uah05034   Alcoholism uah05202   Transcriptional misregulation in cancer uah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     113250165  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     113250165   09163 Immune disease    05322 Systemic lupus erythematosus     113250165   09165 Substance dependence    05034 Alcoholism     113250165  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uah03036]     113250165   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113250165 Chromosome and associated proteins [BR:uah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113250165 Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113250165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  113250165 NCBI-ProteinID:  XP_048076513 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacaaagcagaccgcccgcaagtcgaccggtggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggccgggcaccgtggccctgcgggagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag acggacctgcgcttccagagttcggccgtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgttcgaggacacgaacctgtgcgccatccacgccaagcgcgtcaccatc atgccgaaggacatccagctggctcgccgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system