Ursus arctos (brown bear): 113251181 Help Entry 113251181         CDS       T05909                                  Symbol FGF9 Name (RefSeq) fibroblast growth factor 9   KO K04358   fibroblast growth factor Organism uah  Ursus arctos (brown bear) Pathway uah04010   MAPK signaling pathway uah04014   Ras signaling pathway uah04015   Rap1 signaling pathway uah04020   Calcium signaling pathway uah04151   PI3K-Akt signaling pathway uah04810   Regulation of actin cytoskeleton uah05200   Pathways in cancer uah05207   Chemical carcinogenesis - receptor activation uah05218   Melanoma uah05224   Breast cancer uah05226   Gastric cancer Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113251181 (FGF9)    04014 Ras signaling pathway     113251181 (FGF9)    04015 Rap1 signaling pathway     113251181 (FGF9)    04020 Calcium signaling pathway     113251181 (FGF9)    04151 PI3K-Akt signaling pathway     113251181 (FGF9)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     113251181 (FGF9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     113251181 (FGF9)    05207 Chemical carcinogenesis - receptor activation     113251181 (FGF9)   09162 Cancer: specific types    05226 Gastric cancer     113251181 (FGF9)    05218 Melanoma     113251181 (FGF9)    05224 Breast cancer     113251181 (FGF9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113251181 (FGF9)    00536 Glycosaminoglycan binding proteins [BR:uah00536]     113251181 (FGF9) Cytokines and neuropeptides [BR:uah04052]  Cytokines   Growth factors (RTK binding)    113251181 (FGF9) Glycosaminoglycan binding proteins [BR:uah00536]  Heparan sulfate / Heparin   Growth factors/receptors    113251181 (FGF9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  113251181 NCBI-ProteinID:  XP_026348773 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR HQKFTHFLPRPVDPDKVPELYKDILSQS NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccgtttggg aatgtgcccgtgttgccggtggacagtccggttttgttaagtgaccacctgggtcagtcc gaagcaggggggcttcccaggggacccgcagtcacggacttggatcatttaaaggggatt ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata gcagtgggcctggtcagcattcgaggcgtggacagtggactctacctcgggatgaatgag aagggggagctgtatggatcagaaaaactaacccaagagtgtgtattcagagaacagttt gaagaaaactggtataacacatactcctcgaatctatataaacacgtggacactggaagg cgatactatgttgcattaaataaagacgggaccccaagagaaggaacgaggactaaacgg caccagaaattcacacattttttacctagaccagtggaccccgacaaagtacctgaacta tataaggatattctaagccaaagttga

DBGET integrated database retrieval system