Ursus arctos (brown bear): 113253888 Help Entry 113253888         CDS       T05909                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism uah  Ursus arctos (brown bear) Pathway uah04014   Ras signaling pathway uah04137   Mitophagy - animal uah04144   Endocytosis uah04145   Phagosome uah04148   Efferocytosis uah04962   Vasopressin-regulated water reabsorption uah05014   Amyotrophic lateral sclerosis uah05022   Pathways of neurodegeneration - multiple diseases uah05132   Salmonella infection uah05146   Amoebiasis uah05152   Tuberculosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     113253888 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113253888 (RAB5A)    04145 Phagosome     113253888 (RAB5A)    04137 Mitophagy - animal     113253888 (RAB5A)    04148 Efferocytosis     113253888 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     113253888 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113253888 (RAB5A)    05152 Tuberculosis     113253888 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     113253888 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     113253888 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     113253888 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uah04131]     113253888 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113253888 (RAB5A)    04031 GTP-binding proteins [BR:uah04031]     113253888 (RAB5A) Membrane trafficking [BR:uah04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     113253888 (RAB5A)  Endosome - Lysosome transport     113253888 (RAB5A) Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113253888 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    113253888 (RAB5A)   Exosomal proteins of colorectal cancer cells    113253888 (RAB5A)   Exosomal proteins of bladder cancer cells    113253888 (RAB5A) GTP-binding proteins [BR:uah04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     113253888 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  113253888 NCBI-ProteinID:  XP_026352725 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggcccaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaagggccaatttcatgaatttcaagagagtaccataggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa agagctgtcgatttccaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctgccagaggaagaggagtagac cttactgaacccacgcagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system