Ursus arctos (brown bear): 113255635 Help Entry 113255635         CDS       T05909                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism uah  Ursus arctos (brown bear) Pathway uah04060   Cytokine-cytokine receptor interaction uah04061   Viral protein interaction with cytokine and cytokine receptor uah04151   PI3K-Akt signaling pathway uah04625   C-type lectin receptor signaling pathway uah04630   JAK-STAT signaling pathway uah04658   Th1 and Th2 cell differentiation uah04659   Th17 cell differentiation uah04660   T cell receptor signaling pathway uah04672   Intestinal immune network for IgA production uah04940   Type I diabetes mellitus uah05135   Yersinia infection uah05142   Chagas disease uah05162   Measles uah05166   Human T-cell leukemia virus 1 infection uah05171   Coronavirus disease - COVID-19 uah05200   Pathways in cancer uah05320   Autoimmune thyroid disease uah05321   Inflammatory bowel disease uah05330   Allograft rejection uah05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     113255635 (IL2)    04151 PI3K-Akt signaling pathway     113255635 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113255635 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     113255635 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113255635 (IL2)    04660 T cell receptor signaling pathway     113255635 (IL2)    04658 Th1 and Th2 cell differentiation     113255635 (IL2)    04659 Th17 cell differentiation     113255635 (IL2)    04672 Intestinal immune network for IgA production     113255635 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     113255635 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     113255635 (IL2)    05171 Coronavirus disease - COVID-19     113255635 (IL2)    05162 Measles     113255635 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     113255635 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     113255635 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     113255635 (IL2)    05321 Inflammatory bowel disease     113255635 (IL2)    05330 Allograft rejection     113255635 (IL2)    05332 Graft-versus-host disease     113255635 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     113255635 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113255635 (IL2)    00536 Glycosaminoglycan binding proteins [BR:uah00536]     113255635 (IL2) Cytokines and neuropeptides [BR:uah04052]  Cytokines   Interleukins    113255635 (IL2) Glycosaminoglycan binding proteins [BR:uah00536]  Heparan sulfate / Heparin   Cytokines    113255635 (IL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Portal_T4 Motif Other DBs NCBI-GeneID:  113255635 NCBI-ProteinID:  XP_026355067 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MYKMQLLYCIALTLVLVANSAPTTSSPTKETQQQLEQLLLDLRLLLNGVNNYENPKLSRM LTFKFYMPKKATELKHLQCLAEELKLLEEVLYLDQSKNLHLTDIKELMSNINVTLLKLKG SEASFKCEYDDETVTITEFLNKWITFCQSIFSTLT NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaatgcaactcttgtattgcatcgcactgactcttgtactcgtcgcaaacagt gcacctactacttcaagccctacgaaggaaacacagcaacagctggagcaattgctgctg gatttacggttgctcttgaatggagttaataattatgagaaccccaaactctccaggatg ctcacgtttaaattctacatgcccaagaaggccacagaattgaaacatcttcaatgtcta gcagaagaactcaaacttctggaggaagtgctatatttagatcaaagcaaaaaccttcac ttgacagacatcaaggaattaatgagcaatatcaatgtaacacttctgaaactaaaggga tcagaagcaagtttcaaatgtgaatatgatgacgagacagtaaccattacagaatttctg aacaaatggattactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system