Ursus arctos (brown bear): 113256447 Help Entry 113256447         CDS       T05909                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism uah  Ursus arctos (brown bear) Pathway uah04014   Ras signaling pathway uah04137   Mitophagy - animal uah04144   Endocytosis uah04145   Phagosome uah04148   Efferocytosis uah04962   Vasopressin-regulated water reabsorption uah05132   Salmonella infection uah05146   Amoebiasis uah05152   Tuberculosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     113256447 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113256447 (RAB5B)    04145 Phagosome     113256447 (RAB5B)    04137 Mitophagy - animal     113256447 (RAB5B)    04148 Efferocytosis     113256447 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     113256447 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113256447 (RAB5B)    05152 Tuberculosis     113256447 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     113256447 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uah04131]     113256447 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113256447 (RAB5B)    04031 GTP-binding proteins [BR:uah04031]     113256447 (RAB5B) Membrane trafficking [BR:uah04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     113256447 (RAB5B)  Endosome - Lysosome transport     113256447 (RAB5B) Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113256447 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    113256447 (RAB5B)   Exosomal proteins of colorectal cancer cells    113256447 (RAB5B)   Exosomal proteins of melanoma cells    113256447 (RAB5B) GTP-binding proteins [BR:uah04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     113256447 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  113256447 NCBI-ProteinID:  XP_026356093 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAACRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaaatctagcctggtattacgtttt gtcaaagggcagttccatgagtaccaagagagcaccattggagctgccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggaa cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgcccgagcgaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccttggcggggaacaaagctgaccttgccaataag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgttcatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcatgccgaagccggggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system