Ursus arctos (brown bear): 113256641 Help Entry 113256641         CDS       T05909                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism uah  Ursus arctos (brown bear) Pathway uah04140   Autophagy - animal uah04144   Endocytosis uah04152   AMPK signaling pathway uah04530   Tight junction uah04972   Pancreatic secretion uah05014   Amyotrophic lateral sclerosis uah05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     113256641 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113256641 (RAB8A)    04140 Autophagy - animal     113256641 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     113256641 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     113256641 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     113256641 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     113256641 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uah04131]     113256641 (RAB8A)    03036 Chromosome and associated proteins [BR:uah03036]     113256641 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113256641 (RAB8A)    04031 GTP-binding proteins [BR:uah04031]     113256641 (RAB8A) Membrane trafficking [BR:uah04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     113256641 (RAB8A)  Autophagy   Other autophagy associated proteins     113256641 (RAB8A) Chromosome and associated proteins [BR:uah03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     113256641 (RAB8A) Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113256641 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    113256641 (RAB8A)   Exosomal proteins of colorectal cancer cells    113256641 (RAB8A) GTP-binding proteins [BR:uah04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     113256641 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 Septin DUF3963 AAA_7 DUF6974 Motif Other DBs NCBI-GeneID:  113256641 NCBI-ProteinID:  XP_026356200 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGKKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactcaactttcatctccacc ataggaattgactttaaaattcggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacagcctactacaggggt gcaatgggcatcatgctggtctatgacatcaccaacgagaaatcctttgacaacatccgg aactggattcggaacattgaggagcatgcttctgcagatgtcgaaaagatgatacttggg aacaagtgtgatgtgaacgacaagagacaagtttccaaggaacggggaaaaaagctggcc ctggactacggaatcaagttcatggagaccagtgcaaaggccaacatcaatgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agtccccaagggagcaaccagggagtcaaaatcacaccagaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system