Ursus arctos (brown bear): 113256876 Help Entry 113256876         CDS       T05909                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism uah  Ursus arctos (brown bear) Pathway uah04014   Ras signaling pathway uah04015   Rap1 signaling pathway uah04022   cGMP-PKG signaling pathway uah04024   cAMP signaling pathway uah04062   Chemokine signaling pathway uah04071   Sphingolipid signaling pathway uah04072   Phospholipase D signaling pathway uah04081   Hormone signaling uah04144   Endocytosis uah04150   mTOR signaling pathway uah04270   Vascular smooth muscle contraction uah04310   Wnt signaling pathway uah04350   TGF-beta signaling pathway uah04360   Axon guidance uah04510   Focal adhesion uah04520   Adherens junction uah04530   Tight junction uah04611   Platelet activation uah04621   NOD-like receptor signaling pathway uah04625   C-type lectin receptor signaling pathway uah04660   T cell receptor signaling pathway uah04670   Leukocyte transendothelial migration uah04722   Neurotrophin signaling pathway uah04810   Regulation of actin cytoskeleton uah04921   Oxytocin signaling pathway uah04928   Parathyroid hormone synthesis, secretion and action uah04972   Pancreatic secretion uah05100   Bacterial invasion of epithelial cells uah05132   Salmonella infection uah05133   Pertussis uah05135   Yersinia infection uah05152   Tuberculosis uah05163   Human cytomegalovirus infection uah05200   Pathways in cancer uah05203   Viral carcinogenesis uah05205   Proteoglycans in cancer uah05206   MicroRNAs in cancer uah05210   Colorectal cancer uah05417   Lipid and atherosclerosis uah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     113256876 (RHOA)    04015 Rap1 signaling pathway     113256876 (RHOA)    04310 Wnt signaling pathway     113256876 (RHOA)    04350 TGF-beta signaling pathway     113256876 (RHOA)    04072 Phospholipase D signaling pathway     113256876 (RHOA)    04071 Sphingolipid signaling pathway     113256876 (RHOA)    04024 cAMP signaling pathway     113256876 (RHOA)    04022 cGMP-PKG signaling pathway     113256876 (RHOA)    04150 mTOR signaling pathway     113256876 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     113256876 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113256876 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     113256876 (RHOA)    04520 Adherens junction     113256876 (RHOA)    04530 Tight junction     113256876 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     113256876 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     113256876 (RHOA)    04621 NOD-like receptor signaling pathway     113256876 (RHOA)    04625 C-type lectin receptor signaling pathway     113256876 (RHOA)    04660 T cell receptor signaling pathway     113256876 (RHOA)    04670 Leukocyte transendothelial migration     113256876 (RHOA)    04062 Chemokine signaling pathway     113256876 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     113256876 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     113256876 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     113256876 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     113256876 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     113256876 (RHOA)   09158 Development and regeneration    04360 Axon guidance     113256876 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     113256876 (RHOA)    05206 MicroRNAs in cancer     113256876 (RHOA)    05205 Proteoglycans in cancer     113256876 (RHOA)    05203 Viral carcinogenesis     113256876 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     113256876 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     113256876 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     113256876 (RHOA)    05135 Yersinia infection     113256876 (RHOA)    05133 Pertussis     113256876 (RHOA)    05152 Tuberculosis     113256876 (RHOA)    05100 Bacterial invasion of epithelial cells     113256876 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     113256876 (RHOA)    05418 Fluid shear stress and atherosclerosis     113256876 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uah04131]     113256876 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113256876 (RHOA)    04031 GTP-binding proteins [BR:uah04031]     113256876 (RHOA) Membrane trafficking [BR:uah04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     113256876 (RHOA) Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113256876 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    113256876 (RHOA)   Exosomal proteins of colorectal cancer cells    113256876 (RHOA)   Exosomal proteins of bladder cancer cells    113256876 (RHOA) GTP-binding proteins [BR:uah04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     113256876 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  113256876 NCBI-ProteinID:  XP_026356624 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt ttgctcatcgtctttagcaaggaccagttcccagaggtatatgtacccacagtgtttgag aactatgtggcagatattgaagttgatgggaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggacc ccggaagtcaagcacttctgtcccaacgtacccatcatcctggttgggaacaagaaggac cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtgaaa ccggaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system