Ursus arctos (brown bear): 113257165 Help Entry 113257165         CDS       T05909                                  Symbol GHRL Name (RefSeq) appetite-regulating hormone   KO K05254   ghrelin Organism uah  Ursus arctos (brown bear) Pathway uah04024   cAMP signaling pathway uah04080   Neuroactive ligand-receptor interaction uah04081   Hormone signaling uah04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     113257165 (GHRL)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     113257165 (GHRL)    04081 Hormone signaling     113257165 (GHRL)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     113257165 (GHRL)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113257165 (GHRL) Cytokines and neuropeptides [BR:uah04052]  Neuropeptides   GPCR binding    113257165 (GHRL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Motilin_assoc Motilin_ghrelin Motif Other DBs NCBI-GeneID:  113257165 NCBI-ProteinID:  XP_044241084 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MPSLGTLCSLLLFSVLWMDLAMAGSSFLSPEHQKVQQRKESKKPPAKLQPRALEGSPRPE DTSQVEGAEDELEIRFNAPFDVGIKLSGAQYQEHGQALGKFLQDILWEEANEALADE NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgccctccctggggaccctctgcagcctgctgctcttcagtgtgctctggatggacttg gccatggcgggctccagcttcctgagccctgaacaccagaaagtccagcagagaaaggag tccaagaagccaccagccaaactgcagccccgagctctggaaggctcgccccgcccagaa gacacaagtcaagtggaaggggcagaggatgagctggagatccggttcaatgctcccttt gatgtcggaatcaagctgtccggggctcagtaccaggagcatggccaggcgctggggaag tttcttcaggacatcctctgggaagaggccaacgaggccctggcagacgagtga

DBGET integrated database retrieval system