Ursus arctos (brown bear): 113257255 Help Entry 113257255         CDS       T05909                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism uah  Ursus arctos (brown bear) Pathway uah04137   Mitophagy - animal uah04140   Autophagy - animal uah04144   Endocytosis uah04145   Phagosome uah04148   Efferocytosis uah05132   Salmonella infection uah05146   Amoebiasis uah05152   Tuberculosis Brite KEGG Orthology (KO) [BR:uah00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113257255 (RAB7A)    04145 Phagosome     113257255 (RAB7A)    04140 Autophagy - animal     113257255 (RAB7A)    04137 Mitophagy - animal     113257255 (RAB7A)    04148 Efferocytosis     113257255 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113257255 (RAB7A)    05152 Tuberculosis     113257255 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     113257255 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uah04131]     113257255 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113257255 (RAB7A)    04031 GTP-binding proteins [BR:uah04031]     113257255 (RAB7A) Membrane trafficking [BR:uah04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     113257255 (RAB7A) Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113257255 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    113257255 (RAB7A)   Exosomal proteins of colorectal cancer cells    113257255 (RAB7A)   Exosomal proteins of bladder cancer cells    113257255 (RAB7A) GTP-binding proteins [BR:uah04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     113257255 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_16 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  113257255 NCBI-ProteinID:  XP_026357267 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYSEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagtcacaatgcag atctgggacacggcaggccaggagcggttccagtccctcggcgtggccttctacagaggc gcagactgctgcgttctggtctttgacgttactgcccccaacacgttcaaaaccctcgat agttggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccccttc gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacaattgcacggaatgcacttaaacaggaaacagaggtg gagctgtacagcgaattccccgaacccatcaaactggacaagaacgaccgggccaaggcc tcggcggagagctgcagttgctga

DBGET integrated database retrieval system