KEGG   Ursus arctos (brown bear): 113257792
Entry
113257792         CDS       T05909                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
uah  Ursus arctos (brown bear)
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04062  Chemokine signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04137  Mitophagy - animal
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04218  Cellular senescence
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04371  Apelin signaling pathway
uah04540  Gap junction
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04625  C-type lectin receptor signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04714  Thermogenesis
uah04720  Long-term potentiation
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04726  Serotonergic synapse
uah04730  Long-term depression
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04912  GnRH signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04916  Melanogenesis
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04921  Oxytocin signaling pathway
uah04926  Relaxin signaling pathway
uah04929  GnRH secretion
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah04960  Aldosterone-regulated sodium reabsorption
uah05010  Alzheimer disease
uah05022  Pathways of neurodegeneration - multiple diseases
uah05034  Alcoholism
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05207  Chemical carcinogenesis - receptor activation
uah05208  Chemical carcinogenesis - reactive oxygen species
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05216  Thyroid cancer
uah05218  Melanoma
uah05219  Bladder cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113257792 (KRAS)
   04012 ErbB signaling pathway
    113257792 (KRAS)
   04014 Ras signaling pathway
    113257792 (KRAS)
   04015 Rap1 signaling pathway
    113257792 (KRAS)
   04370 VEGF signaling pathway
    113257792 (KRAS)
   04371 Apelin signaling pathway
    113257792 (KRAS)
   04068 FoxO signaling pathway
    113257792 (KRAS)
   04072 Phospholipase D signaling pathway
    113257792 (KRAS)
   04071 Sphingolipid signaling pathway
    113257792 (KRAS)
   04151 PI3K-Akt signaling pathway
    113257792 (KRAS)
   04150 mTOR signaling pathway
    113257792 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113257792 (KRAS)
   04137 Mitophagy - animal
    113257792 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    113257792 (KRAS)
   04218 Cellular senescence
    113257792 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113257792 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    113257792 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113257792 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113257792 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    113257792 (KRAS)
   04660 T cell receptor signaling pathway
    113257792 (KRAS)
   04662 B cell receptor signaling pathway
    113257792 (KRAS)
   04664 Fc epsilon RI signaling pathway
    113257792 (KRAS)
   04062 Chemokine signaling pathway
    113257792 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113257792 (KRAS)
   04929 GnRH secretion
    113257792 (KRAS)
   04912 GnRH signaling pathway
    113257792 (KRAS)
   04915 Estrogen signaling pathway
    113257792 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    113257792 (KRAS)
   04917 Prolactin signaling pathway
    113257792 (KRAS)
   04921 Oxytocin signaling pathway
    113257792 (KRAS)
   04926 Relaxin signaling pathway
    113257792 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    113257792 (KRAS)
   04919 Thyroid hormone signaling pathway
    113257792 (KRAS)
   04916 Melanogenesis
    113257792 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113257792 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    113257792 (KRAS)
   04726 Serotonergic synapse
    113257792 (KRAS)
   04720 Long-term potentiation
    113257792 (KRAS)
   04730 Long-term depression
    113257792 (KRAS)
   04722 Neurotrophin signaling pathway
    113257792 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    113257792 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    113257792 (KRAS)
   04213 Longevity regulating pathway - multiple species
    113257792 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    113257792 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113257792 (KRAS)
   05206 MicroRNAs in cancer
    113257792 (KRAS)
   05205 Proteoglycans in cancer
    113257792 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    113257792 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    113257792 (KRAS)
   05203 Viral carcinogenesis
    113257792 (KRAS)
   05230 Central carbon metabolism in cancer
    113257792 (KRAS)
   05231 Choline metabolism in cancer
    113257792 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113257792 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113257792 (KRAS)
   05212 Pancreatic cancer
    113257792 (KRAS)
   05225 Hepatocellular carcinoma
    113257792 (KRAS)
   05226 Gastric cancer
    113257792 (KRAS)
   05214 Glioma
    113257792 (KRAS)
   05216 Thyroid cancer
    113257792 (KRAS)
   05221 Acute myeloid leukemia
    113257792 (KRAS)
   05220 Chronic myeloid leukemia
    113257792 (KRAS)
   05218 Melanoma
    113257792 (KRAS)
   05211 Renal cell carcinoma
    113257792 (KRAS)
   05219 Bladder cancer
    113257792 (KRAS)
   05215 Prostate cancer
    113257792 (KRAS)
   05213 Endometrial cancer
    113257792 (KRAS)
   05224 Breast cancer
    113257792 (KRAS)
   05223 Non-small cell lung cancer
    113257792 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113257792 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    113257792 (KRAS)
   05161 Hepatitis B
    113257792 (KRAS)
   05160 Hepatitis C
    113257792 (KRAS)
   05163 Human cytomegalovirus infection
    113257792 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113257792 (KRAS)
   05165 Human papillomavirus infection
    113257792 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113257792 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    113257792 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    113257792 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    113257792 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113257792 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113257792 (KRAS)
   01522 Endocrine resistance
    113257792 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113257792 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:uah04031]
    113257792 (KRAS)
Membrane trafficking [BR:uah04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113257792 (KRAS)
GTP-binding proteins [BR:uah04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113257792 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha ATP_bind_1 FeoB_N Septin DUF6974
Other DBs
NCBI-GeneID: 113257792
NCBI-ProteinID: XP_026358035
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKINKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacaatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgcgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcggcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcaacaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

DBGET integrated database retrieval system