Ursus arctos (brown bear): 113260378 Help Entry 113260378         CDS       T05909                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism uah  Ursus arctos (brown bear) Pathway uah04010   MAPK signaling pathway uah04020   Calcium signaling pathway uah04022   cGMP-PKG signaling pathway uah04114   Oocyte meiosis uah04218   Cellular senescence uah04310   Wnt signaling pathway uah04360   Axon guidance uah04370   VEGF signaling pathway uah04380   Osteoclast differentiation uah04625   C-type lectin receptor signaling pathway uah04650   Natural killer cell mediated cytotoxicity uah04658   Th1 and Th2 cell differentiation uah04659   Th17 cell differentiation uah04660   T cell receptor signaling pathway uah04662   B cell receptor signaling pathway uah04720   Long-term potentiation uah04724   Glutamatergic synapse uah04921   Oxytocin signaling pathway uah04922   Glucagon signaling pathway uah04924   Renin secretion uah05010   Alzheimer disease uah05014   Amyotrophic lateral sclerosis uah05020   Prion disease uah05022   Pathways of neurodegeneration - multiple diseases uah05031   Amphetamine addiction uah05152   Tuberculosis uah05163   Human cytomegalovirus infection uah05166   Human T-cell leukemia virus 1 infection uah05167   Kaposi sarcoma-associated herpesvirus infection uah05170   Human immunodeficiency virus 1 infection uah05235   PD-L1 expression and PD-1 checkpoint pathway in cancer uah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113260378 (PPP3R2)    04310 Wnt signaling pathway     113260378 (PPP3R2)    04370 VEGF signaling pathway     113260378 (PPP3R2)    04020 Calcium signaling pathway     113260378 (PPP3R2)    04022 cGMP-PKG signaling pathway     113260378 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     113260378 (PPP3R2)    04218 Cellular senescence     113260378 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     113260378 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     113260378 (PPP3R2)    04660 T cell receptor signaling pathway     113260378 (PPP3R2)    04658 Th1 and Th2 cell differentiation     113260378 (PPP3R2)    04659 Th17 cell differentiation     113260378 (PPP3R2)    04662 B cell receptor signaling pathway     113260378 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     113260378 (PPP3R2)    04921 Oxytocin signaling pathway     113260378 (PPP3R2)    04924 Renin secretion     113260378 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     113260378 (PPP3R2)    04720 Long-term potentiation     113260378 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     113260378 (PPP3R2)    04380 Osteoclast differentiation     113260378 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     113260378 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     113260378 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     113260378 (PPP3R2)    05163 Human cytomegalovirus infection     113260378 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     113260378 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     113260378 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     113260378 (PPP3R2)    05014 Amyotrophic lateral sclerosis     113260378 (PPP3R2)    05020 Prion disease     113260378 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     113260378 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     113260378 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     113260378 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:uah01009]     113260378 (PPP3R2) Protein phosphatases and associated proteins [BR:uah01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      113260378 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 DUF6967 Motif Other DBs NCBI-GeneID:  113260378 NCBI-ProteinID:  XP_026361895 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPEEMCSHFNPDEIKRLGKRFKKLDLDSSGALSLEEFMSLPELQQNPLVQRVVD VFDTDGNGEVDFKEFILGTSQFSVRGDEEQKLRFAFSIYDIDKDGYISNGELFQVLKLMV GNNLKDWQLQQLVDKTIIILDQDGDGKISFEEFCTVVGGLEIHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagccagttacccggaggaaatgtgctcccacttcaaccctgacgaaatc aaaaggctgggcaagaggtttaagaagctggacttggactcttcgggcgcactgagcctg gaggagttcatgtccctgcccgagctgcagcagaatccgttggtgcagcgagtggtcgac gtcttcgacaccgacggcaacggagaagtggacttcaaggagttcatcctggggacctcc cagttcagcgtcaggggggacgaggagcaaaagttgaggtttgccttcagcatctacgac atcgataaagacggctacatttccaacggggagctcttccaggtgctgaagctgatggtg ggcaacaacctgaaggactggcagctgcagcagctcgtggacaaaaccatcatcatcctg gaccaggatggagacggcaaaatatccttcgaggaattctgcactgtggtcggaggcctg gagatccacaagaagttggtggtgatagtgtga

DBGET integrated database retrieval system