Ursus arctos (brown bear): 113261579 Help Entry 113261579         CDS       T05909                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism uah  Ursus arctos (brown bear) Pathway uah04024   cAMP signaling pathway uah04080   Neuroactive ligand-receptor interaction uah04920   Adipocytokine signaling pathway uah04923   Regulation of lipolysis in adipocytes uah05034   Alcoholism Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     113261579 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     113261579 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     113261579 (NPY)    04920 Adipocytokine signaling pathway     113261579 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     113261579 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113261579 (NPY) Cytokines and neuropeptides [BR:uah04052]  Neuropeptides   GPCR binding    113261579 (NPY) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  113261579 NCBI-ProteinID:  XP_048069013 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MLGSKRLGLSGLTLALSLLVCLGALVEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctgggtagcaagcgactggggctatccggactgaccctcgccctgtccctgcttgtg tgcctgggcgcgctggttgaggcgtacccctccaagccagacaaccccggagaggacgcg ccggcagaggacatggccagatactattcagcgctgcgacactacatcaacctcatcacc aggcagaggtatggaaaacgatctagccctgagacactgatttcagacctcttgatgaga gaaagcacagaaaatgttcccagaactaggctggaagacccttccatgtggtga

DBGET integrated database retrieval system