Ursus arctos (brown bear): 113261704 Help Entry 113261704         CDS       T05909                                  Name (RefSeq) interleukin-3-like   KO K04736   interleukin 3 Organism uah  Ursus arctos (brown bear) Pathway uah04060   Cytokine-cytokine receptor interaction uah04151   PI3K-Akt signaling pathway uah04210   Apoptosis uah04630   JAK-STAT signaling pathway uah04640   Hematopoietic cell lineage uah04664   Fc epsilon RI signaling pathway uah05200   Pathways in cancer uah05202   Transcriptional misregulation in cancer uah05221   Acute myeloid leukemia uah05310   Asthma Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     113261704    04151 PI3K-Akt signaling pathway     113261704   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113261704  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     113261704  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     113261704    04664 Fc epsilon RI signaling pathway     113261704  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     113261704    05202 Transcriptional misregulation in cancer     113261704   09162 Cancer: specific types    05221 Acute myeloid leukemia     113261704   09163 Immune disease    05310 Asthma     113261704  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113261704    00536 Glycosaminoglycan binding proteins [BR:uah00536]     113261704 Cytokines and neuropeptides [BR:uah04052]  Cytokines   Interleukins    113261704 Glycosaminoglycan binding proteins [BR:uah00536]  Heparan sulfate / Heparin   Cytokines    113261704 SSDB OrthologParalogGFIT Motif Pfam:  IL3 Motif Other DBs NCBI-GeneID:  113261704 NCBI-ProteinID:  XP_026363707 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MHSLPILHVLLLLLGLRAPMAQGRSLSTYQPKQYFKMISEIMDILNNSPSPSEETLDPNE TSTLLNTTLLRPNLDAFLNATKNFYNSESLIWKNLKEFLPLLPTPTPRGQPISIENNLGD FQKKLKKYLEALDNFLNFKNKQ NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgcacagcctccccatcttgcacgttctcctgctcctgcttggactccgagccccaatg gcacaggggcgctccttgtccacataccagcctaagcaatacttcaagatgatcagtgaa attatggacatcttaaacaattcaccctcaccttcagaagaaaccttggacccaaatgag acaagcaccctgctgaacactacccttctgaggccaaacctggatgcattcttgaatgct accaaaaatttctacaacagtgaatcgctaatctggaaaaatcttaaggaattcctgcca ctcctgcccactcccacacccagggggcaaccaatctctatcgagaataacttgggtgat ttccaaaagaagctgaaaaagtatctggaagcccttgacaactttctgaatttcaagaac aagcaatga

DBGET integrated database retrieval system