Ursus arctos (brown bear): 113261714 Help Entry 113261714         CDS       T05909                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism uah  Ursus arctos (brown bear) Pathway uah04060   Cytokine-cytokine receptor interaction uah04630   JAK-STAT signaling pathway uah04640   Hematopoietic cell lineage uah04657   IL-17 signaling pathway uah04658   Th1 and Th2 cell differentiation uah04660   T cell receptor signaling pathway uah04664   Fc epsilon RI signaling pathway uah04672   Intestinal immune network for IgA production uah05200   Pathways in cancer uah05310   Asthma uah05320   Autoimmune thyroid disease uah05321   Inflammatory bowel disease uah05330   Allograft rejection Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     113261714 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113261714 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     113261714 (IL5)    04660 T cell receptor signaling pathway     113261714 (IL5)    04658 Th1 and Th2 cell differentiation     113261714 (IL5)    04657 IL-17 signaling pathway     113261714 (IL5)    04664 Fc epsilon RI signaling pathway     113261714 (IL5)    04672 Intestinal immune network for IgA production     113261714 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     113261714 (IL5)   09163 Immune disease    05310 Asthma     113261714 (IL5)    05320 Autoimmune thyroid disease     113261714 (IL5)    05321 Inflammatory bowel disease     113261714 (IL5)    05330 Allograft rejection     113261714 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113261714 (IL5)    00536 Glycosaminoglycan binding proteins [BR:uah00536]     113261714 (IL5) Cytokines and neuropeptides [BR:uah04052]  Cytokines   Interleukins    113261714 (IL5) Glycosaminoglycan binding proteins [BR:uah00536]  Heparan sulfate / Heparin   Cytokines    113261714 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  113261714 NCBI-ProteinID:  XP_026363733 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVSVTAAESTMNGLVAETLTLLSAHRTLLIGDGNLMIPTPEHKNH QLCIEEVFQGIDILKNRTAQGEAVDKLFRNLSLIKQHIEHQKKKCAGERWRVKKFLDYLQ VFLGVINTEWTTES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact gctgcagaaagtaccatgaatggactggtggcagagaccttgacactgctctctgctcat cgaactctgctgataggagatgggaacctgatgattcctactcctgaacataaaaatcac caactgtgcattgaagaagtctttcagggcatagacatattgaagaaccgaactgcacaa ggggaggctgtggataaactattccggaacttgtctttaataaaacaacacatagagcac caaaaaaaaaagtgtgcaggagagagatggagagtaaaaaagttcctagactacctgcaa gtgtttcttggtgtcataaacaccgagtggacaacagaaagttga

DBGET integrated database retrieval system