Ursus arctos (brown bear): 113264150 Help Entry 113264150         CDS       T05909                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism uah  Ursus arctos (brown bear) Pathway uah04015   Rap1 signaling pathway uah04810   Regulation of actin cytoskeleton uah05014   Amyotrophic lateral sclerosis uah05132   Salmonella infection Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     113264150 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     113264150 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113264150 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     113264150 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uah04131]     113264150 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:uah04812]     113264150 (PFN3)    04147 Exosome [BR:uah04147]     113264150 (PFN3) Membrane trafficking [BR:uah04131]  Others   Actin-binding proteins    Others     113264150 (PFN3) Cytoskeleton proteins [BR:uah04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      113264150 (PFN3) Exosome [BR:uah04147]  Exosomal proteins   Proteins found in most exosomes    113264150 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  113264150 NCBI-ProteinID:  XP_026366860 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI LNKTVHELIKGLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaaaggctatatcagtgcggtgctgcgggaccagcgcattgacgatgtg gccatcgtgggccactcagacaatcgctgcgtgtgggcatcgcgtccaggaggccttctg gctgccatatcaccgcaagaggtgggtgtgctcacagggcctgatcggcgcaccttcctg caggccggcctgagcgtggcaggccgccgctgctgcgtcatccgcgaccacttgctgtct gagggcgatggagttctggacgcacgcactaaggggctggatgggcgtgcggtctgcgtg ggccacaccccgcgcgtgctcctcgtgctcatgggccgacggggcgtgcacgggggcatc ctcaacaagacagtgcatgaactaatcaaggggctgcgcacacagggcacctag

DBGET integrated database retrieval system