Ursus arctos (brown bear): 113265171 Help Entry 113265171         CDS       T05909                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism uah  Ursus arctos (brown bear) Pathway uah04081   Hormone signaling uah04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     113265171 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     113265171 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113265171 (GAST) Cytokines and neuropeptides [BR:uah04052]  Neuropeptides   GPCR binding    113265171 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin PsbT Motif Other DBs NCBI-GeneID:  113265171 NCBI-ProteinID:  XP_026368058 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCVYVLVLALALATFSEASWKPHSQLQDAPSGAGANRGLEPHWLDRLGAAPHQRRQL GLQGPPQLVADLSKKQGPWLEEEEAAYGWMDFGRRSAEEGDRRP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgtgtacgtgctggtcctggcactggctctggccaccttctctgaa gcttcttggaagccccactcccagctgcaggatgcaccctcgggtgcaggggcaaatagg ggcctggagccacactggctggaccggctgggcgcagcccctcaccagcgaaggcagcta gggctccagggtcccccacagctggtggcagacctgtccaagaagcagggaccgtggctg gaggaggaagaagcagcatatggatggatggacttcggccgccgcagcgctgaggaaggg gaccgacgtccctag

DBGET integrated database retrieval system