Ursus arctos (brown bear): 113266201 Help Entry 113266201         CDS       T05909                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism uah  Ursus arctos (brown bear) Pathway uah04014   Ras signaling pathway uah04072   Phospholipase D signaling pathway uah04144   Endocytosis uah04517   IgSF CAM signaling uah04666   Fc gamma R-mediated phagosome formation uah05132   Salmonella infection uah05135   Yersinia infection Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     113266201 (ARF6)    04072 Phospholipase D signaling pathway     113266201 (ARF6)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     113266201 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113266201 (ARF6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     113266201 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113266201 (ARF6)    05135 Yersinia infection     113266201 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uah04131]     113266201 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113266201 (ARF6)    04031 GTP-binding proteins [BR:uah04031]     113266201 (ARF6) Membrane trafficking [BR:uah04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     113266201 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     113266201 (ARF6) Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113266201 (ARF6)   Exosomal proteins of colorectal cancer cells    113266201 (ARF6) GTP-binding proteins [BR:uah04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     113266201 (ARF6) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  113266201 NCBI-ProteinID:  XP_026369468 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctgtccaagatcttcgggaacaaggaaatgcggatcctcatgttgggc ctggacgcggccggcaagacgacaatcctgtacaagctgaagctgggccagtcggtgacc accattcccaccgtgggtttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggacgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg acccagggtctgatcttcgtagtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc gccaacaaacaggacctgcccgatgccatgaaaccccacgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctcaggggat ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system