KEGG   Ursus arctos horribilis (North American brown bear): 113267724
Entry
113267724         CDS       T05909                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
uah  Ursus arctos horribilis (North American brown bear)
Pathway
uah04610  Complement and coagulation cascades
uah04810  Regulation of actin cytoskeleton
uah05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113267724 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    113267724 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113267724 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:uah04515]
    113267724 (ITGAX)
   04090 CD molecules [BR:uah04090]
    113267724 (ITGAX)
Cell adhesion molecules [BR:uah04515]
 Integrins
  Integrin alpha subunits
   113267724 (ITGAX)
CD molecules [BR:uah04090]
 Proteins
  113267724 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE
Other DBs
NCBI-GeneID: 113267724
NCBI-ProteinID: XP_026371667
UniProt: A0A3Q7Y483
LinkDB
Position
Unknown
AA seq 1166 aa
MSDLPVMTGTRSSLLLLMALASSLCFNLDTDQPKTFLMDSAGFGHSVVQYGNAWVVVGAP
QEIKAANQTGGLYQCDYSTGKCEPIRLQVPPEAVNMSLGLSLAASTNPSQLLACGPTVHH
ICRENVYLSGFCFLLGSPSWQAQRLPAALQECPRQEQDIVFLIDGSGSISSDDFTKMLNF
VKAVMSQFQRPNTQFSLMQFSHNFRVHFTFKDFTYSSNPLALLESVYQLGGYTHTATAIQ
RVTNQLFSTSSGARKDASKILIVITDGQKQGDYLNYEDVIPMAEAAGIIRYAVGVGSAFQ
KRHSWKELNDIASKPSNEYIFKVDNFDVLRDIQNQLKEKIFAIEGTQTSSSSSFELEMSQ
EGFSAVFTPDGPVLGAVGSFSWSGGAFLYAPNKSPTFINMSQENVDMRDSYLGYSAELAF
WKGVQSLILGAPRHQHTGKAVIFTQTSEQWRPKAEVTGTQIGSYFGASLLTVDVDRDGSS
DLVLIGAPHYYKPTQGGQVSVCPFPQGRAKWQCEVILCGEQGHPWGRFGAALTVLGDVNG
DKLTDVAIGAPGEQESRGAVYLFHGTSRPGISPSHSQRISASQLSPRLQYFGQSLSGGQD
LTLDGLVDLAVGAQGQVLLLRTRPVLRAWMSVRFKPAEIARSLFECQKETSSVNTLGDAD
VCLQIYESPKNRLGNLQSSVTFDLTLDPGRQNPRAIFEETKTWNLTRVRDLGLRQHCETV
KLLLLACVEDTVTPITLRLNFSLVGKPIPSFGNLQPMLAVDAQRYYTASLPFEKNCGTDH
VCQDDLGISFGFSGLETLLVGSTLELNMKVVVWNDGEDSYGTTVTLFYPPGLSYRRVAGI
KNQLQPHSPRLTCDGAPAQGQSIQSTRCSINHLILQGGNQITFLVTFDVSPKAMLGDRLL
LTANVSSENNTPRTNKSTFQLELMVKYAIYTVISSHEQSTKYLNFSASDQKKSSQAQHRY
RVNNLGQRDLPISIIFSVPVELNGVPVWTELEVFHPQNPSIQCSSERIVHTESDFLRHIQ
KNSLLNCSIADCLRFQCDFPSFGIQEELDFILKGNLSFGWVSQTLQKKVLVVSVAEVTFN
RSVYSQLPGQEAFLRAQIETVLEKYEVYNPLPIIVGSSVGGLLLLALITAILYKVGFFKR
QYKEMMAEASGQTVPEDGTSGPQVAQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtctgaccttccagtcatgactgggaccagatcatccctcctcctgttgatggccttg
gcttcttctctctgcttcaacttggacacggaccagccaaaaaccttccttatggacagt
gctggatttggacacagcgtggtccagtatggcaacgcctgggtggtggttggagccccc
caggagataaaggcggccaaccaaacaggcggcctctaccagtgtgactacagcacgggc
aagtgtgagcccatccgcctgcaggtccccccggaagctgtgaacatgtccctgggcctg
tccctggcagcctccactaacccctctcagctgttggcctgtggccccacagtgcaccat
atatgcagggagaatgtgtacttgtctggattctgcttcctgctgggctccccttcctgg
caagcccagaggctcccggctgccctgcaggagtgtccgaggcaagagcaggatattgtg
ttcctgatcgacggctcaggcagcatctcctccgatgattttaccaagatgctgaatttc
gtgaaggctgtgatgagccagttccagagacctaacacccagttctccctgatgcagttt
tcccacaatttccgggtgcacttcactttcaaagacttcacctacagctccaacccgcta
gccctgctggaatctgtatatcagctgggaggatacactcacacagccacagccatccaa
agggtcacaaaccaactgttcagtacctcaagcggggcccgaaaagatgcctccaagatc
ctcattgtcatcaccgatgggcaaaaacaaggcgactacctgaattatgaggatgtcatc
cctatggctgaggctgcgggtatcatccgctatgcagttggggtgggatcggcttttcaa
aagagacattcctggaaagaattaaatgacattgcatcgaagccctccaatgagtacatt
tttaaagtggacaattttgatgttttgagagacatacaaaaccaactaaaagagaagatc
tttgccattgagggtacgcagacctcaagcagtagttcctttgaattggagatgtcccag
gagggcttcagcgctgtgttcacacctgatggaccagttctgggggctgtggggagcttc
agctggtctggtggtgccttcctgtacgccccaaacaagagccccactttcatcaacatg
tctcaagagaatgtggacatgagggactcttacctgggttactccgctgagctggccttt
tggaagggggtccagagcctgatcctgggggctccccgtcatcagcatactgggaaggct
gtcatcttcacccagacgtccgagcaatggaggccaaaagctgaagtcacagggacccag
attggctcctactttggggcctccctcctcactgtggacgtggatagagatggcagctct
gaccttgtcctcatcggggctccccattactacaagccgacccaggggggccaggtgtct
gtgtgtcccttcccccaggggagggctaagtggcagtgtgaggtcattctctgtggggag
cagggccacccctggggccgctttggggcagccctgacagtgctgggggatgtgaatggg
gacaagctgacagacgtggccatcggggccccaggagagcaggagagccggggtgccgtc
tacctctttcatggaacctcaagaccgggcatcagcccctcccacagtcagaggatctca
gcctcccagctctcccccaggctccagtattttgggcagtcactgagtgggggtcaggac
cttaccctggatggactggtggaccttgctgtgggggcccaggggcaggtgctgctgctc
aggaccagacctgtactcagggcgtggatgagcgtccgattcaaacctgcagagatagcc
aggtctctgtttgagtgtcagaaagagacctcctctgtcaacaccctgggtgatgccgat
gtctgccttcaaatttatgaaagtcccaagaatcggctgggtaacctccaaagctctgtg
acctttgacctgaccctcgaccctggccgccagaatccccgtgccatctttgaggagaca
aagacctggaacctgactcgtgtccgagaccttgggctgagacagcactgtgagactgtg
aagttactgctcctggcctgtgtggaggacacagtgacccccatcaccttgcgtctcaac
ttctccctggtgggcaagcctatcccttcctttggaaacctccagcctatgttggctgtg
gatgctcagagatattacacagcctctctcccctttgagaagaattgtggaactgaccat
gtctgccaggatgacctcggcatctcctttggcttctcaggcttggagaccctgttggtg
gggagtaccctggagctgaatatgaaagtggtggtgtggaatgatggtgaggactcctat
ggaaccacagtcaccctcttctacccaccagggctgtcttatcgacgcgtggcagggatc
aagaaccagctgcagccacactccccacgcctgacctgtgatggcgccccagcccagggc
cagagcattcagagcacccgctgtagcatcaaccatctcatcctccaggggggtaaccag
atcaccttcctggtcacctttgatgtctcccccaaggccatgctgggagaccggctgctt
ctgacggctaatgtgagcagtgaaaataacactcccaggaccaacaagagcacctttcag
ttggagctcatggtgaaatatgccatctacaccgtaatcagcagccatgaacagtccacc
aagtatctcaacttctcagcctcagaccagaagaaaagcagccaggctcagcatagatac
cgggtgaacaacctgggacaaagggacctgccgatcagcatcatcttctctgtgcctgtg
gagctgaatggggtacctgtgtggacagagttagaggtcttccatccccagaacccctcc
attcagtgctcttcagagagaatagtgcacacagagtctgacttcctaaggcacattcag
aagaattctctgctgaactgctccatcgctgactgtctgaggttccagtgtgacttcccc
tcctttggcatccaggaggaactggacttcatcctgaagggcaacctcagttttggttgg
gtcagccagacattgcagaagaaggtattggtggtgagtgtggctgaagtcacattcaac
aggtccgtgtattcccagcttccaggacaggaggcattcttgagagctcagatagagacg
gtgctggagaaatatgaggtctacaaccccctccccattattgtgggaagctctgtggga
ggactgctgctgctggctctcattacggccatcctatacaaggttggcttcttcaaacgt
cagtataaagaaatgatggcagaagcaagtggacagactgtcccagaagatgggacttca
ggccctcaagttgcccaataa

DBGET integrated database retrieval system