Ursus arctos (brown bear): 113267786 Help Entry 113267786         CDS       T05909                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism uah  Ursus arctos (brown bear) Pathway uah03272   Virion - Hepatitis viruses uah04382   Cornified envelope formation uah04514   Cell adhesion molecule (CAM) interaction uah04530   Tight junction uah04670   Leukocyte transendothelial migration uah05160   Hepatitis C Brite KEGG Orthology (KO) [BR:uah00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     113267786 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     113267786 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     113267786 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     113267786 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     113267786 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     113267786 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:uah03037]     113267786 (CLDN4)    04147 Exosome [BR:uah04147]     113267786 (CLDN4) Cilium and associated proteins [BR:uah03037]  Other cilia and associated proteins   Stereociliary proteins    113267786 (CLDN4) Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    113267786 (CLDN4)   Exosomal proteins of colorectal cancer cells    113267786 (CLDN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM37 CdpA_N Motif Other DBs NCBI-GeneID:  113267786 NCBI-ProteinID:  XP_026371776 LinkDB All DBs Position Unknown AA seq 209 aa AA seqDB search MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALMVICIIVAVLGVLLSVVGGKCTNCVEDESAKAKTMIV AGVVFLLAGLLVMVPASWTANTIIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGAL LCCNCPPRTDKPYSAKYSAARSAPASNYV NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggcctccatggggctgcaggtgatggggatcgcgctggccgtgctgggctggctgggc gccatcctgagctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatc gtcacgtcgcagaccatctgggagggcctgtggatgaactgcgtggtgcagagcaccggc cagatgcagtgcaaggtgtacgactcgctgctggccctgccgcaggacctgcaggcggcc cgggccctcatggtcatctgcatcatcgtggccgtgctgggcgtgctgctgtcggtggtg ggtggcaagtgcaccaactgcgtggaggacgagagcgccaaggccaagaccatgattgtg gcgggcgtggtgttcctgctggccggcctgctggtcatggtgccggcgtcctggacggcc aacaccatcatccgggacttctacaacccgctggtggcctctggccagaagcgggagatg ggcgcctctctctacatcggctgggccgcctcgggcctgctgctgctcgggggggccctt ctctgctgcaactgcccaccccgcaccgacaagccctactcggccaagtactcggccgct cgctccgccccagccagcaactacgtgtaa

DBGET integrated database retrieval system