KEGG   Ursus arctos (brown bear): 113267943
Entry
113267943         CDS       T05909                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X2
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
uah  Ursus arctos (brown bear)
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04071  Sphingolipid signaling pathway
uah04145  Phagosome
uah04148  Efferocytosis
uah04151  PI3K-Akt signaling pathway
uah04310  Wnt signaling pathway
uah04360  Axon guidance
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04517  IgSF CAM signaling
uah04518  Integrin signaling
uah04519  Cadherin signaling
uah04520  Adherens junction
uah04530  Tight junction
uah04613  Neutrophil extracellular trap formation
uah04620  Toll-like receptor signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04670  Leukocyte transendothelial migration
uah04722  Neurotrophin signaling pathway
uah04810  Regulation of actin cytoskeleton
uah04932  Non-alcoholic fatty liver disease
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04972  Pancreatic secretion
uah05014  Amyotrophic lateral sclerosis
uah05020  Prion disease
uah05022  Pathways of neurodegeneration - multiple diseases
uah05100  Bacterial invasion of epithelial cells
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05163  Human cytomegalovirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
uah05205  Proteoglycans in cancer
uah05208  Chemical carcinogenesis - reactive oxygen species
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05231  Choline metabolism in cancer
uah05415  Diabetic cardiomyopathy
uah05416  Viral myocarditis
uah05417  Lipid and atherosclerosis
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113267943 (RAC1)
   04014 Ras signaling pathway
    113267943 (RAC1)
   04015 Rap1 signaling pathway
    113267943 (RAC1)
   04310 Wnt signaling pathway
    113267943 (RAC1)
   04370 VEGF signaling pathway
    113267943 (RAC1)
   04071 Sphingolipid signaling pathway
    113267943 (RAC1)
   04024 cAMP signaling pathway
    113267943 (RAC1)
   04151 PI3K-Akt signaling pathway
    113267943 (RAC1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    113267943 (RAC1)
   04518 Integrin signaling
    113267943 (RAC1)
   04519 Cadherin signaling
    113267943 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113267943 (RAC1)
   04148 Efferocytosis
    113267943 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113267943 (RAC1)
   04520 Adherens junction
    113267943 (RAC1)
   04530 Tight junction
    113267943 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113267943 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    113267943 (RAC1)
   04620 Toll-like receptor signaling pathway
    113267943 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    113267943 (RAC1)
   04662 B cell receptor signaling pathway
    113267943 (RAC1)
   04664 Fc epsilon RI signaling pathway
    113267943 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    113267943 (RAC1)
   04670 Leukocyte transendothelial migration
    113267943 (RAC1)
   04062 Chemokine signaling pathway
    113267943 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    113267943 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113267943 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    113267943 (RAC1)
   04380 Osteoclast differentiation
    113267943 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113267943 (RAC1)
   05205 Proteoglycans in cancer
    113267943 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    113267943 (RAC1)
   05203 Viral carcinogenesis
    113267943 (RAC1)
   05231 Choline metabolism in cancer
    113267943 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113267943 (RAC1)
   05212 Pancreatic cancer
    113267943 (RAC1)
   05211 Renal cell carcinoma
    113267943 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113267943 (RAC1)
   05163 Human cytomegalovirus infection
    113267943 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113267943 (RAC1)
   05169 Epstein-Barr virus infection
    113267943 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113267943 (RAC1)
   05135 Yersinia infection
    113267943 (RAC1)
   05100 Bacterial invasion of epithelial cells
    113267943 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    113267943 (RAC1)
   05020 Prion disease
    113267943 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    113267943 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    113267943 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    113267943 (RAC1)
   05415 Diabetic cardiomyopathy
    113267943 (RAC1)
   05416 Viral myocarditis
    113267943 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    113267943 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113267943 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113267943 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113267943 (RAC1)
   04031 GTP-binding proteins [BR:uah04031]
    113267943 (RAC1)
Membrane trafficking [BR:uah04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    113267943 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    113267943 (RAC1)
  Macropinocytosis
   Ras GTPases
    113267943 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    113267943 (RAC1)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113267943 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   113267943 (RAC1)
  Exosomal proteins of colorectal cancer cells
   113267943 (RAC1)
  Exosomal proteins of bladder cancer cells
   113267943 (RAC1)
GTP-binding proteins [BR:uah04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    113267943 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 113267943
NCBI-ProteinID: XP_026372078
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtcgtgggagacggagctgtaggtaaaacttgcctactg
atcagttatacaaccaatgcatttcctggagaatacatccccactgtctttgacaactac
tccgccaatgttatggtagatggaaaacccgtgaatctgggcttatgggatacagctgga
caagaagattatgaccgattacgtcccttatcctacccgcaaacagatgtattcttaatt
tgcttttctcttgtgagtcctgcatcatttgaaaacgttcgagcaaagtggtaccccgaa
gtgcgacaccactgtcccaacacccccatcatcttggtggggactaaacttgatctcagg
gatgataaagacacgatcgagaagctgaaggaaaagaagctgactcccatcacctacccg
cagggtctggccatggctaaggagatcggtgcggtaaaatacctggagtgctcggcgctc
acgcagcgaggcctcaagacagtgtttgatgaagcgattcgagcggttctctgtcctcct
cccgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system