Ursus arctos (brown bear): 113268145 Help Entry 113268145         CDS       T05909                                  Name (RefSeq) ferritin light chain-like   KO K13625   ferritin light chain Organism uah  Ursus arctos (brown bear) Pathway uah00860   Porphyrin metabolism uah04216   Ferroptosis uah04217   Necroptosis uah04978   Mineral absorption Brite KEGG Orthology (KO) [BR:uah00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     113268145  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     113268145    04217 Necroptosis     113268145  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     113268145  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113268145 Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    113268145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Hrs_helical Motif Other DBs NCBI-GeneID:  113268145 NCBI-ProteinID:  XP_044246284 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MEYLELAEEKLKGAERPRKVQNQSSVGALFQDVQKPSQDEWHKTLDTMEAAMVQEKSLNP RLLDLHALGSAPQTQLGDFLEIHFPDEKVKLIKKMDDHVTNLPKMAVPQEWLGESLLERL TLKHGYEPLTASSL NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggaatatctcgaattggctgaggagaagctcaaaggcgctgagcgtccccggaaggtg caaaaccagagcagtgttggtgccctgttccaggacgtgcagaagccctcccaagatgag tggcataaaaccctggacaccatggaagctgccatggttcaggagaagagcctgaaccca cgccttttggatctgcatgccctgggttctgccccgcagacccagcttggagacttcctg gagatccacttcccggatgaaaaggtgaaactcatcaagaagatggatgaccacgtgact aacctccccaagatggctgttccccaggaatggctgggtgagtctctcttggaaaggctc accctcaagcatggctacgagcctctgacggccagcagcctttga

DBGET integrated database retrieval system