Ursus arctos (brown bear): 113268942 Help Entry 113268942         CDS       T05909                                  Name (RefSeq) C-C motif chemokine 14-like   KO K21092   C-C motif chemokine 14 Organism uah  Ursus arctos (brown bear) Pathway uah04060   Cytokine-cytokine receptor interaction uah04061   Viral protein interaction with cytokine and cytokine receptor uah04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113268942    04061 Viral protein interaction with cytokine and cytokine receptor     113268942  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     113268942  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113268942 Cytokines and neuropeptides [BR:uah04052]  Cytokines   Chemokines    113268942 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  113268942 NCBI-ProteinID:  XP_026373361 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MIISQHLFSPGASEVPTRSALPLRLLPTRRMKVSPARRMKVSMAAISLLLILITCALGRK AEFSSRGPYHPAECCVSYIAQAIPRHRITDYYETSSQCSRPGIVFMTKKGHSVCANPSDD WVQDYIKDLEGNE NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgatcatttctcaacacctcttcagcccaggagcctccgaagtccctaccaggtcagct ctccccctgcggctgctccccaccaggaggatgaaggtctcccccgccaggaggatgaag gtctccatggcagccatctccctcctcctcatcctcatcacctgtgccctggggcgcaag gctgaattctcctcacgtggaccttaccacccggccgagtgctgcgtcagctacattgcc caggcaatcccacgtcaccggatcacagattattatgagaccagcagccagtgctccagg cctgggattgtcttcatgaccaaaaagggccattccgtatgtgccaaccccagtgatgac tgggtccaggactacatcaaggacctggagggaaatgagtga

DBGET integrated database retrieval system