Ursus arctos (brown bear): 113268951 Help Entry 113268951         CDS       T05909                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism uah  Ursus arctos (brown bear) Pathway uah04060   Cytokine-cytokine receptor interaction uah04061   Viral protein interaction with cytokine and cytokine receptor uah04062   Chemokine signaling pathway uah04620   Toll-like receptor signaling pathway uah04621   NOD-like receptor signaling pathway uah04623   Cytosolic DNA-sensing pathway uah04668   TNF signaling pathway uah05020   Prion disease uah05142   Chagas disease uah05163   Human cytomegalovirus infection uah05164   Influenza A uah05168   Herpes simplex virus 1 infection uah05323   Rheumatoid arthritis uah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     113268951 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113268951 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     113268951 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113268951 (CCL5)    04621 NOD-like receptor signaling pathway     113268951 (CCL5)    04623 Cytosolic DNA-sensing pathway     113268951 (CCL5)    04062 Chemokine signaling pathway     113268951 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     113268951 (CCL5)    05168 Herpes simplex virus 1 infection     113268951 (CCL5)    05163 Human cytomegalovirus infection     113268951 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     113268951 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     113268951 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     113268951 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     113268951 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113268951 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:uah00536]     113268951 (CCL5) Cytokines and neuropeptides [BR:uah04052]  Cytokines   Chemokines    113268951 (CCL5) Glycosaminoglycan binding proteins [BR:uah00536]  Heparan sulfate / Heparin   Chemokines    113268951 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  113268951 NCBI-ProteinID:  XP_026373373 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKVSAATFAVLLATAAFCAPASASPYASDTTPCCFAYISRRLPFTHIQEYFYTSSKCSMP AVVFVTRKHRQVCADPQKKWVRDHINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagccacctttgcggtcctcctcgccactgctgccttctgcgctcct gcctctgcctccccatatgcctcggacaccacaccctgctgctttgcctacatctcccgc cgactgcccttcacccacatccaggagtatttctacaccagcagcaagtgctccatgcca gcggtcgtctttgtcacccgaaagcaccgccaggtgtgtgccgatccacagaagaaatgg gtgcgggaccacatcaactctttggagatgagttag

DBGET integrated database retrieval system