Ursus arctos (brown bear): 113270511 Help Entry 113270511         CDS       T05909                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism uah  Ursus arctos (brown bear) Pathway uah04015   Rap1 signaling pathway uah04810   Regulation of actin cytoskeleton uah05014   Amyotrophic lateral sclerosis uah05132   Salmonella infection Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     113270511 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     113270511 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113270511 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     113270511 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uah04131]     113270511 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:uah04812]     113270511 (PFN4)    04147 Exosome [BR:uah04147]     113270511 (PFN4) Membrane trafficking [BR:uah04131]  Others   Actin-binding proteins    Others     113270511 (PFN4) Cytoskeleton proteins [BR:uah04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      113270511 (PFN4) Exosome [BR:uah04147]  Exosomal proteins   Proteins found in most exosomes    113270511 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  113270511 NCBI-ProteinID:  XP_026375646 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSIMPGDVRTLVNGFAKNPLQTR REGLYFKEKDYKCIRADDYSLYAKNENTGVIVVKTHMYLLVATYTEGMYPSVCVEATEKL GEYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatctgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaagaacgaagcttgtgtgtagcatcaccaggatttagtata atgcctggtgatgtccgaacacttgtgaatggattcgccaagaaccctttgcaaaccaga agagaaggattgtatttcaaggaaaaggactacaaatgtatccgggcagatgactattct ctttatgctaagaatgaaaacactggtgtgattgttgtgaagacccatatgtatcttctg gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaagctg ggagaatatctaagaaaaaaaggaaattaa

DBGET integrated database retrieval system