Ursus arctos (brown bear): 125283245 Help Entry 125283245         CDS       T05909                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism uah  Ursus arctos (brown bear) Pathway uah04060   Cytokine-cytokine receptor interaction uah04151   PI3K-Akt signaling pathway uah04217   Necroptosis uah04620   Toll-like receptor signaling pathway uah04621   NOD-like receptor signaling pathway uah04622   RIG-I-like receptor signaling pathway uah04623   Cytosolic DNA-sensing pathway uah04630   JAK-STAT signaling pathway uah04650   Natural killer cell mediated cytotoxicity uah04936   Alcoholic liver disease uah05152   Tuberculosis uah05160   Hepatitis C uah05161   Hepatitis B uah05162   Measles uah05163   Human cytomegalovirus infection uah05164   Influenza A uah05165   Human papillomavirus infection uah05167   Kaposi sarcoma-associated herpesvirus infection uah05168   Herpes simplex virus 1 infection uah05169   Epstein-Barr virus infection uah05170   Human immunodeficiency virus 1 infection uah05171   Coronavirus disease - COVID-19 uah05200   Pathways in cancer uah05320   Autoimmune thyroid disease uah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125283245    04151 PI3K-Akt signaling pathway     125283245   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125283245  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125283245  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125283245    04621 NOD-like receptor signaling pathway     125283245    04622 RIG-I-like receptor signaling pathway     125283245    04623 Cytosolic DNA-sensing pathway     125283245    04650 Natural killer cell mediated cytotoxicity     125283245  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125283245   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125283245    05161 Hepatitis B     125283245    05160 Hepatitis C     125283245    05171 Coronavirus disease - COVID-19     125283245    05164 Influenza A     125283245    05162 Measles     125283245    05168 Herpes simplex virus 1 infection     125283245    05163 Human cytomegalovirus infection     125283245    05167 Kaposi sarcoma-associated herpesvirus infection     125283245    05169 Epstein-Barr virus infection     125283245    05165 Human papillomavirus infection     125283245   09171 Infectious disease: bacterial    05152 Tuberculosis     125283245   09163 Immune disease    05320 Autoimmune thyroid disease     125283245   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125283245   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125283245  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     125283245 Cytokines and neuropeptides [BR:uah04052]  Cytokines   Interferons    125283245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  125283245 NCBI-ProteinID:  XP_048079210 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKRMSASSCDGYTRDFA FPKEVVDGKQLQKAQAFSVVYVMNQKIFHVFCTEASSAAWNTTLLEEFCSGLSEQLSVLE ACPMQAAGLGETPGMNVDSILRNYFQRISLYLQAKQYSPCAWETVRAEITSSLFSSTILQ EGLRRKK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacgtgactttgcc ttccccaaggaggtggttgatggtaagcagttgcagaaggctcaagccttctcggtcgtt tatgtgatgaaccagaagatcttccacgtcttctgcacagaggcctcatctgctgcttgg aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctggaa gcctgtcccatgcaggcggcgggattgggagagactcccggcatgaatgtggactccatc ctgaggaactacttccaaagaatctccctctacctgcaagcgaagcaatacagcccttgt gcctgggagactgtcagagcagaaatcacgagctccttgttttcttcaacgatcttgcaa gaaggactaaggcgcaagaaatga

DBGET integrated database retrieval system