Ursus arctos (brown bear): 125283535 Help Entry 125283535         CDS       T05909                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism uah  Ursus arctos (brown bear) Pathway uah04613   Neutrophil extracellular trap formation uah05034   Alcoholism uah05202   Transcriptional misregulation in cancer uah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125283535  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     125283535   09163 Immune disease    05322 Systemic lupus erythematosus     125283535   09165 Substance dependence    05034 Alcoholism     125283535  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uah03036]     125283535   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     125283535 Chromosome and associated proteins [BR:uah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125283535 Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125283535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  125283535 NCBI-ProteinID:  XP_048081502 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgtatccgtggagagagggcgtaa

DBGET integrated database retrieval system