Ursus arctos (brown bear): 130542243 Help Entry 130542243         CDS       T05909                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism uah  Ursus arctos (brown bear) Pathway uah04613   Neutrophil extracellular trap formation uah05034   Alcoholism uah05203   Viral carcinogenesis uah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     130542243  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     130542243   09163 Immune disease    05322 Systemic lupus erythematosus     130542243   09165 Substance dependence    05034 Alcoholism     130542243  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uah03036]     130542243 Chromosome and associated proteins [BR:uah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130542243 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  130542243 NCBI-ProteinID:  XP_057160996 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctaa

DBGET integrated database retrieval system