Ursus arctos (brown bear): 130543975 Help Entry 130543975         CDS       T05909                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism uah  Ursus arctos (brown bear) Pathway uah04613   Neutrophil extracellular trap formation uah05034   Alcoholism uah05203   Viral carcinogenesis uah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     130543975  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     130543975   09163 Immune disease    05322 Systemic lupus erythematosus     130543975   09165 Substance dependence    05034 Alcoholism     130543975  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uah03036]     130543975   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     130543975 Chromosome and associated proteins [BR:uah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130543975 Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130543975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  130543975 NCBI-ProteinID:  XP_057169358 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MAEPGCGTSSEESLGTEEPSAADPKSPKQKQPRRQCRRHCLRRRRRPDSFATYFPRVLKQ VHEGLSLSKKAVSVMDSFVKDIFERIADEAARLARSTKGSNKHSTISSREIQTAVRLLLP GEIGKHAVSEATKAIIRYTLCQ NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggctgagcctggctgtgggacctcttctgaggaaagcctgggcacggaggaaccctcg gcagccgacccgaagagcccgaagcagaagcagccgaggcgccaatgccgccgccactgc ctccgccgccgccgccgccccgacagtttcgccacctacttccccagggttctgaagcag gtgcacgagggcctgagcctctcgaagaaggccgtgagcgtcatggattcgttcgttaag gacatcttcgagcgcatcgccgacgaggccgctcgtctggctcgctccaccaagggctcc aacaagcactccaccatcagctccagggagatccagacagccgtgcgcctgctgctgccc ggggagatcggcaagcacgccgtgtccgaggccaccaaggccatcatcaggtacacctta tgccaatga

DBGET integrated database retrieval system