Ursus americanus (American black bear): 123775710 Help Entry 123775710         CDS       T07931                                  Symbol URM1 Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism uar  Ursus americanus (American black bear) Pathway uar04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:uar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     123775710 (URM1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:uar03016]     123775710 (URM1)    04121 Ubiquitin system [BR:uar04121]     123775710 (URM1) Transfer RNA biogenesis [BR:uar03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     123775710 (URM1) Ubiquitin system [BR:uar04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    123775710 (URM1) SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  123775710 NCBI-ProteinID:  XP_045627127 UniProt:  A0A452S237 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MAAPLSVEVEFGGGAELLFDGIKKHQVTLPGREEPWDIRNLLVWIKKNLLKERPELFIQG DSVRPGILVLVNDADWELLGELDYQLQDQDSVLFISTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcagcgcccttgtcagtggaggtggagttcggaggcggtgcggagctcctttttgac ggcataaagaaacatcaggtcaccttacctggacgggaggagccctgggacatccggaac ctccttgtctggatcaagaagaatttgctgaaagagcggccagagttgttcatccaggga gacagcgtgcggccaggaattctggtgctggttaacgatgcggactgggaactgctgggt gagctcgactaccagctgcaggaccaggacagcgtcctcttcatatccacgctgcatggc ggctga

DBGET integrated database retrieval system