Ursus americanus (American black bear): 123776190 Help Entry 123776190         CDS       T07931                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism uar  Ursus americanus (American black bear) Pathway uar04613   Neutrophil extracellular trap formation uar05034   Alcoholism uar05203   Viral carcinogenesis uar05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uar00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123776190  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     123776190   09163 Immune disease    05322 Systemic lupus erythematosus     123776190   09165 Substance dependence    05034 Alcoholism     123776190  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uar03036]     123776190   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123776190 Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123776190 Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123776190 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF CCDC106 Circo_capsid Motif Other DBs NCBI-GeneID:  123776190 NCBI-ProteinID:  XP_045627960 LinkDB All DBs Position Unknown AA seq 145 aa AA seqDB search MAEPGCGTSSEESLGTEEPSAADPKNPKQKQPRRQCRRHCLRRRRRRRRPDSFATYFPRV LKQVHEGLSLSKKAVSVMDSFVKDIFERIADEAARLARSTKGSNKHSTISSREIQTAVRL LLPGEIGKHAVSEATKAIIRYTLCQ NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atggctgagcctggctgtgggacctcttctgaggaaagcctgggcacggaggaaccctcg gcagccgacccaaagaacccgaagcagaagcagccgaggcgccaatgccgccgccactgc ctccgccgccgccgccgccgccgccgccccgacagtttcgccacctacttccccagggtt ctgaagcaggtgcacgagggcctgagcctctcgaagaaggccgtgagcgtcatggattcg ttcgttaaggacatcttcgagcgcatcgccgacgaggccgctcgtctggctcgctccacc aagggctccaacaagcactccaccatcagctccagggagatccagacagccgtgcgcctg ctgctgcccggggagatcggcaagcacgccgtgtccgaggccaccaaggccatcatcagg tacaccttatgccaatga

DBGET integrated database retrieval system